SecReT4
Protein ID: 19352390
T4SS name [ID]Trb [61]
Gene symboltrbG
Locus tagpB4p51
Strainuncultured bacterium plasmid pB4 (NC_003430)
Repliconplasmid pB4 [GenBank: NC_003430] [Browse all T4SS(s) in this replicon]
Location [Strand]46914..47828 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDQ8RSJ1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.1e-64, Aligned region: 79..303
Protein Sequence: 304 a.a.     [Download]
>gi|19352390|ref|NP_598148.1| TrbG protein [uncultured bacterium]
MNPRTFTMKKIFSVVALGAALLSPTLALAADDLADKYFTGKNPTLTPQERAAIDIAKRWNAGAATGMKPV
AGSNGAIKFLFGAQQPSIVCAVLQVCDVALQPGEQVNSINLGDTARWTVEPAITGSGPNEVQHLIIKPMD
VGLETSLIVTTNRRAYHLRLRSHRTEYMPQVSFTYPEDALAKWDAIQRRETQERTDRTIPQTGEYLGDLK
FDYDLSGSASWKPVRVFNDGRKTIIEMPGTMEQTEAPTLLVVRREGGIFRDEETVMVNYRVQGNRYIVDT
VFDRAILIAGVGGSQDRVTISRRK
 
Nucleotide Sequence: 915 bp     [Download]
>gi|19352339|ref|NC_003430.1|:46914-47828 Uncultured bacterium plasmid pB4, complete sequence
ATGAACCCAAGGACATTCACCATGAAGAAAATCTTTTCCGTTGTCGCCTTGGGCGCTGCGCTGCTGTCGC
CCACCCTGGCCCTGGCCGCCGACGACCTGGCCGACAAGTATTTCACCGGCAAGAACCCTACGCTGACGCC
TCAAGAGCGCGCGGCCATCGACATTGCGAAGCGATGGAACGCGGGCGCTGCCACCGGCATGAAGCCCGTC
GCCGGCTCCAATGGCGCGATCAAGTTCCTGTTCGGCGCGCAGCAGCCCAGCATCGTGTGCGCGGTGCTCC
AGGTGTGCGACGTGGCCTTGCAGCCAGGCGAGCAAGTCAACTCGATCAACCTGGGCGACACGGCCCGGTG
GACGGTCGAGCCGGCCATCACCGGCAGCGGCCCCAACGAAGTGCAGCACCTCATCATCAAGCCGATGGAT
GTTGGCCTGGAAACCAGCCTCATCGTGACGACGAACCGCCGCGCCTATCACCTGCGCCTGCGCTCGCATC
GCACCGAGTACATGCCGCAAGTCTCGTTCACCTACCCCGAGGACGCGCTTGCGAAGTGGGACGCGATCCA
GCGCCGCGAAACGCAAGAACGCACCGACCGCACCATCCCGCAAACCGGCGAGTACCTGGGCGATCTCAAG
TTCGACTATGACCTGTCCGGCTCGGCGAGCTGGAAGCCGGTGCGTGTGTTCAACGATGGCCGCAAGACCA
TCATCGAAATGCCCGGAACGATGGAGCAAACCGAAGCGCCGACGCTCCTGGTCGTGCGCCGCGAGGGCGG
CATCTTCCGCGACGAGGAAACCGTGATGGTGAACTATCGCGTGCAGGGCAATCGCTACATCGTGGACACG
GTGTTTGACCGCGCGATCCTGATTGCCGGTGTTGGTGGAAGCCAAGACCGCGTGACTATCTCCCGGAGGA
AGTGA
 Primer design