SecReT4
Protein ID: 19352391
T4SS name [ID]Trb [61]
Gene symboltrbH
Locus tagpB4p52
Strainuncultured bacterium plasmid pB4 (NC_003430)
Repliconplasmid pB4 [GenBank: NC_003430] [Browse all T4SS(s) in this replicon]
Location [Strand]47831..48292 [+]
Productconjugal transfer protein TrbH
Component typeTrbH
UniProt IDQ8RSJ0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbH [PF07283], Evalue: 1.2e-48, Aligned region: 32..153
Protein Sequence: 153 a.a.     [Download]
>gi|19352391|ref|NP_598149.1| TrbH protein [uncultured bacterium]
MRKIIFAALFVLALGGCATTGQYGNFVPPTATVDQQQLAREAVQQLAVLYPPAKTRLELQQATPDAFGQA
LVLTLRERGYALLEFNPASAKAQATAASEPASPAALPLRYVLDQAGDSNLYRLTLLVGHQSITRPYLVQD
GSFAPAGYWVRKE
 
Nucleotide Sequence: 462 bp     [Download]
>gi|19352339|ref|NC_003430.1|:47831-48292 Uncultured bacterium plasmid pB4, complete sequence
ATGCGCAAGATCATCTTTGCTGCGCTGTTCGTCCTCGCCCTGGGCGGCTGCGCGACCACCGGCCAATACG
GCAACTTCGTCCCGCCGACCGCAACGGTCGATCAGCAGCAGCTCGCCCGCGAAGCGGTGCAGCAGCTCGC
CGTGCTGTACCCGCCGGCCAAGACGCGCCTGGAGCTGCAACAGGCCACGCCTGATGCCTTCGGCCAGGCC
CTGGTGCTGACGTTGCGCGAGCGCGGCTATGCCCTCCTGGAGTTCAACCCGGCCAGCGCGAAGGCGCAGG
CCACGGCGGCCAGTGAGCCGGCATCGCCGGCGGCTCTGCCGCTGCGGTACGTGCTCGACCAGGCCGGCGA
CTCGAACCTGTACCGCCTGACTCTGTTGGTCGGCCATCAATCCATCACCCGCCCGTACCTGGTGCAAGAC
GGCAGCTTTGCGCCGGCTGGGTATTGGGTGCGCAAGGAGTGA
 Primer design