SecReT4
Protein ID: 19352392
T4SS name [ID]Trb [61]
Gene symboltrbI
Locus tagpB4p53
Strainuncultured bacterium plasmid pB4 (NC_003430)
Repliconplasmid pB4 [GenBank: NC_003430] [Browse all T4SS(s) in this replicon]
Location [Strand]48296..49678 [+]
Productconjugal transfer protein TrbI
Component typeTrbI
UniProt IDQ8RSI9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 5.2e-65, Aligned region: 267..451
Protein Sequence: 460 a.a.     [Download]
>gi|19352392|ref|NP_598150.1| TrbI protein [uncultured bacterium]
MSDQADQMAPDASPGAVSKKSGVRRVNNMPMYILAAALGAFLLVMMLVAADRAAKQNAPAQGAAEKAGNT
SMFAKEIVGDRDGGTVEAASPLKPPELATGPEAAPVLVARPDLDAPPPPPSGNLGQPVHDDEADRIRMAK
LQMFQEAVKAKTGVRVDAPRSSGSSGAQPGTPQTRDEMLSRLAAVRQQIGAQASGDPTAAYQARLAQLRA
SGVGGQQAGGGVGGGAPQLLQTAGGGQGKNYAQFAGSGQGDRWRLDSQPEAPRSPFELRAGFVVPATLIS
GINSDLPGQIMAQVAQNVYDTPTGKHLLIPQGSRLVGSYSSDVAYGQSRVLVAWQRIVFPDGKAMDIGTM
PGADSAGYAGFNDQVNNHYLRVFGSAFLMSGVIAAVSLSQDNGNSSTGNQQRASDALSEALGQVLGNTIA
QIISKNLNIAPTLEIRPGYRFNVIVTKDMTFSKPYQAFDY
 
Nucleotide Sequence: 1383 bp     [Download]
>gi|19352339|ref|NC_003430.1|:48296-49678 Uncultured bacterium plasmid pB4, complete sequence
ATGAGTGACCAAGCCGATCAAATGGCACCGGACGCCTCGCCGGGCGCGGTGTCGAAGAAGTCCGGCGTGC
GGCGTGTCAACAACATGCCGATGTACATCCTTGCGGCCGCGCTGGGTGCCTTCCTGCTGGTGATGATGCT
GGTCGCGGCGGATCGCGCTGCGAAGCAGAACGCACCGGCGCAAGGCGCGGCCGAGAAGGCGGGTAACACG
TCGATGTTCGCCAAGGAGATCGTCGGCGACAGGGATGGCGGCACGGTAGAAGCGGCCTCGCCGCTCAAGC
CGCCGGAGCTGGCGACCGGGCCAGAGGCTGCGCCGGTGCTTGTCGCGCGCCCCGACCTGGACGCGCCGCC
GCCACCGCCCAGCGGCAACCTGGGCCAGCCGGTGCATGACGATGAAGCCGACCGCATCCGCATGGCGAAG
CTGCAAATGTTCCAGGAAGCGGTCAAGGCCAAGACGGGCGTTCGTGTCGATGCGCCGCGCAGCAGCGGGT
CATCGGGCGCGCAGCCGGGCACGCCGCAAACGCGCGACGAAATGCTGTCCCGCCTGGCGGCTGTGCGGCA
GCAAATCGGTGCGCAAGCATCGGGCGATCCGACCGCCGCCTATCAGGCCCGGCTCGCGCAGCTTCGCGCC
TCGGGCGTCGGCGGCCAGCAGGCCGGCGGCGGCGTGGGTGGTGGTGCGCCGCAGCTCTTGCAAACCGCCG
GTGGCGGCCAGGGCAAGAACTACGCGCAGTTCGCGGGAAGCGGCCAGGGCGACCGTTGGCGGCTGGACTC
CCAGCCCGAAGCGCCGCGCTCGCCCTTCGAGCTGCGCGCCGGCTTCGTGGTGCCGGCCACGCTCATTTCT
GGCATCAACTCCGACTTGCCGGGCCAGATCATGGCCCAGGTCGCGCAGAACGTGTACGACACGCCGACCG
GCAAGCATCTGCTGATTCCGCAAGGCTCGCGCCTGGTCGGGTCGTATTCGAGCGATGTTGCCTACGGTCA
GTCGCGCGTGCTTGTGGCTTGGCAGCGCATCGTGTTCCCCGATGGCAAGGCGATGGACATTGGCACGATG
CCGGGCGCGGATAGCGCCGGGTACGCGGGCTTCAATGACCAGGTGAATAACCACTACCTGCGCGTGTTCG
GCTCGGCCTTCCTCATGTCGGGCGTCATCGCCGCCGTGAGCTTGAGCCAGGACAACGGCAACAGCTCGAC
AGGCAATCAGCAGCGCGCAAGCGATGCTCTTAGCGAAGCACTTGGGCAAGTGCTGGGCAACACCATCGCC
CAAATCATTTCCAAGAATCTGAACATTGCTCCGACCTTGGAAATCCGCCCCGGCTATCGCTTCAACGTCA
TCGTGACGAAGGACATGACGTTCTCGAAGCCGTACCAAGCCTTTGACTACTAA
 Primer design