SecReT4
Protein ID: 19352393
T4SS name [ID]Trb [61]
Gene symboltrbJ
Locus tagpB4p54
Strainuncultured bacterium plasmid pB4 (NC_003430)
Repliconplasmid pB4 [GenBank: NC_003430] [Browse all T4SS(s) in this replicon]
Location [Strand]49695..50468 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDQ8RSI8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 3.5e-05, Aligned region: 30..195
Protein Sequence: 257 a.a.     [Download]
>gi|19352393|ref|NP_598151.1| TrbJ protein [uncultured bacterium]
MKQKFLAAKVALVVALMGGALVSPPPASAGIPVIDGTNLAQNIMTAVESVAQTLKQIEQYRTQLQQYENM
LQNTAAPAAYIWDQAQTTINGLMNAVDTLNYYKTQLGSVDSYLGKFQDVAYYRSSPCFNGTGGCTPAEQA
AMAENRRLASESQKKANDALFKGLDRQQDALKADARQLERLQSAAQGANGQMQAIGFANQLAAQQANQLL
QIRGLLVAQQNAIATRMQAEADREAQQQVSSEALRKGDYRASPARNW
 
Nucleotide Sequence: 774 bp     [Download]
>gi|19352339|ref|NC_003430.1|:49695-50468 Uncultured bacterium plasmid pB4, complete sequence
ATGAAGCAGAAGTTTTTAGCCGCTAAAGTGGCCCTCGTCGTGGCCCTGATGGGCGGTGCTCTTGTCAGTC
CGCCGCCGGCCTCGGCAGGTATTCCCGTCATCGACGGCACCAACCTGGCGCAAAACATCATGACCGCCGT
TGAGTCGGTGGCCCAGACCCTCAAGCAGATCGAGCAATACCGGACGCAGTTGCAGCAGTACGAAAACATG
CTGCAAAACACCGCCGCGCCGGCGGCCTACATCTGGGATCAGGCGCAGACCACGATCAACGGGCTGATGA
ATGCCGTCGATACACTGAACTACTACAAGACCCAGCTCGGCAGCGTCGATTCGTACCTGGGCAAGTTCCA
GGACGTGGCCTACTACCGCAGCTCGCCGTGCTTCAACGGCACCGGCGGCTGCACGCCGGCCGAACAGGCC
GCGATGGCCGAGAACCGCCGCCTGGCGAGCGAGAGCCAGAAGAAGGCGAACGACGCGCTTTTCAAGGGCC
TGGATCGCCAGCAGGACGCCTTGAAGGCTGACGCTCGCCAGCTCGAACGGCTCCAGTCGGCCGCGCAAGG
TGCGAACGGGCAGATGCAGGCCATCGGCTTCGCCAACCAGCTCGCGGCCCAGCAGGCAAACCAGCTTCTG
CAAATCCGTGGCCTCCTGGTCGCGCAGCAGAACGCCATCGCCACGCGGATGCAGGCCGAGGCCGACCGTG
AAGCCCAGCAGCAGGTTTCGTCCGAGGCGCTGCGCAAGGGCGACTACAGGGCCAGCCCGGCCCGCAATTG
GTAA
 Primer design