SecReT4
Protein ID: 19352394
T4SS name [ID]Trb [61]
Gene symboltrbK
Locus tagpB4p55
Strainuncultured bacterium plasmid pB4 (NC_003430)
Repliconplasmid pB4 [GenBank: NC_003430] [Browse all T4SS(s) in this replicon]
Location [Strand]50478..50696 [+]
ProductTrbK protein
Component typeTrbK
UniProt IDQ8RSI7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 72 a.a.     [Download]
>gi|19352394|ref|NP_598152.1| TrbK protein [uncultured bacterium]
MRLNPLILAAAALAAALLAGCEKKPEPVTLPEVNAENCKPENIAKLDKSVQQAFSSQCLRAGSFKPSEPK
TW
 
Nucleotide Sequence: 219 bp     [Download]
>gi|19352339|ref|NC_003430.1|:50478-50696 Uncultured bacterium plasmid pB4, complete sequence
ATGCGACTTAATCCCTTGATCCTGGCAGCGGCCGCCCTCGCGGCGGCCCTGCTGGCCGGCTGCGAGAAGA
AGCCCGAGCCGGTCACGTTGCCCGAAGTGAACGCCGAGAACTGCAAGCCCGAGAACATCGCCAAGCTCGA
TAAGAGCGTGCAACAGGCGTTTTCATCGCAGTGCCTGCGGGCCGGCTCGTTCAAGCCCAGCGAACCCAAG
ACTTGGTGA
 Primer design