SecReT4
Protein ID: 19352395
T4SS name [ID]Trb [61]
Gene symboltrbL
Locus tagpB4p56
Strainuncultured bacterium plasmid pB4 (NC_003430)
Repliconplasmid pB4 [GenBank: NC_003430] [Browse all T4SS(s) in this replicon]
Location [Strand]50708..52420 [+]
ProductTrbL protein
Component typeTrbL
UniProt IDQ8RSI6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.7e-39, Aligned region: 65..279
Protein Sequence: 570 a.a.     [Download]
>gi|19352395|ref|NP_598153.1| TrbL protein [uncultured bacterium]
MRMPASLKLALPLLVWLAFFSLDAQAQALDSAGLFDDVLNRYNAAASGWAGVITDAASWLFWTLVVISMV
WTFGMMALRKADIGEFFAELVRFTIFTGFFWWLLTNGPNFASTIYASLRQVAGNATGLGNALSPSGIVDV
GFAIFYKVMDQSSVWSPVDSMAGILMAVAILVVLALTGVNMLLLLASGWVLAYGGVFFLGFGGSRWTSDM
AINYYKTVLGVAAQLMATVLLVGIGKTFLDDYYARMSAGINLKEMGVMLIVCVILLALVNKIPALIAGII
TGASVGGAGIGNFGAGAALGAAGMAAAAAATGGAALAAGAASAAGGASAVMAAFSKANGNVSSGSDVMSM
LGGGGGGDSGGGGGGGGDAGTSTPLGQAAGFGGGGGGGGGGGGESKGGDKAGGDKAGSSSKGGEGGGQKA
SGGGDAGGAKGGQGGGQQGQGAGQGGQQAAPGSTDPGLLATAASALGKAGRVTADAGANLAKGAGAVAAA
KAASLRDAAAERIADTTGGKIAAAIKAQGSSSADAATDTPDQQPSPTFGDNSLAGATSADPESEVAAFAN
RDGDRSDKSA
 
Nucleotide Sequence: 1713 bp     [Download]
>gi|19352339|ref|NC_003430.1|:50708-52420 Uncultured bacterium plasmid pB4, complete sequence
ATGAGAATGCCAGCCAGCTTGAAACTCGCCCTGCCGCTGCTCGTTTGGCTGGCGTTCTTTTCCCTGGACG
CACAAGCCCAAGCACTGGACAGCGCGGGCCTCTTCGATGACGTTCTGAATCGCTACAACGCCGCCGCCAG
CGGCTGGGCCGGGGTCATCACCGATGCCGCGTCCTGGCTCTTCTGGACGTTGGTTGTGATCTCGATGGTC
TGGACGTTCGGCATGATGGCCTTGCGCAAGGCCGACATTGGCGAGTTCTTCGCGGAGCTTGTCCGCTTCA
CCATCTTCACCGGCTTTTTCTGGTGGCTGCTGACGAACGGGCCGAACTTCGCTTCAACGATCTATGCGTC
GCTTCGCCAGGTGGCCGGCAACGCGACCGGCCTGGGCAATGCCCTGTCTCCATCGGGCATTGTCGATGTG
GGCTTTGCCATCTTCTACAAGGTGATGGATCAGTCCTCGGTGTGGTCGCCGGTGGACAGCATGGCCGGCA
TTCTCATGGCGGTGGCCATCCTGGTCGTGCTCGCTCTCACCGGCGTGAACATGCTTCTTCTCCTGGCGTC
CGGCTGGGTGCTCGCCTATGGCGGCGTGTTCTTCCTCGGCTTCGGTGGAAGCCGTTGGACTTCCGACATG
GCGATCAACTACTACAAGACCGTGCTGGGCGTGGCCGCGCAGCTCATGGCGACGGTGCTCCTGGTCGGCA
TCGGCAAGACCTTCCTGGACGACTACTACGCGCGCATGAGCGCCGGGATCAACCTCAAGGAAATGGGCGT
GATGCTCATCGTCTGCGTGATCCTGCTGGCCCTGGTCAACAAGATTCCGGCGCTCATCGCCGGGATCATC
ACCGGCGCGAGCGTGGGCGGTGCCGGCATCGGCAACTTCGGTGCAGGCGCGGCCCTCGGTGCCGCTGGCA
TGGCGGCCGCAGCAGCGGCAACCGGCGGTGCTGCTCTGGCGGCCGGCGCGGCCTCGGCCGCCGGCGGTGC
TTCGGCGGTCATGGCCGCGTTCTCCAAGGCCAATGGAAACGTCTCGTCCGGCTCGGATGTCATGTCGATG
CTGGGCGGCGGCGGTGGCGGCGACTCCGGCGGCGGCGGTGGTGGTGGCGGTGACGCCGGCACCAGCACGC
CCCTGGGCCAAGCCGCCGGTTTCGGCGGCGGCGGTGGTGGCGGCGGCGGTGGCGGCGGGGAGTCGAAGGG
CGGCGACAAGGCCGGCGGCGATAAGGCCGGCTCCAGCTCGAAGGGTGGCGAAGGCGGCGGCCAGAAGGCC
AGCGGCGGCGGTGACGCCGGCGGCGCGAAGGGCGGCCAGGGTGGCGGCCAGCAGGGCCAGGGAGCGGGGC
AGGGCGGCCAGCAGGCAGCACCAGGCAGTACCGACCCCGGCCTGCTCGCAACGGCCGCTTCGGCGCTCGG
CAAGGCCGGCCGCGTGACGGCCGATGCCGGCGCGAACTTGGCGAAGGGTGCCGGCGCTGTCGCGGCCGCG
AAGGCCGCCAGCCTCCGCGATGCCGCTGCCGAACGCATCGCAGACACCACCGGCGGAAAGATCGCCGCCG
CCATCAAGGCGCAGGGCAGCAGCTCGGCCGACGCCGCCACCGACACGCCGGATCAACAACCGTCGCCGAC
CTTCGGCGACAACAGCCTGGCAGGCGCTACCTCTGCCGATCCCGAGTCCGAAGTGGCCGCGTTCGCTAAC
CGCGACGGCGACCGCAGCGACAAATCCGCTTAA
 Primer design