SecReT4
Protein ID: 19352397
T4SS name [ID]Trb [61]
Gene symboltrbN
Locus tagpB4p58
Strainuncultured bacterium plasmid pB4 (NC_003430)
Repliconplasmid pB4 [GenBank: NC_003430] [Browse all T4SS(s) in this replicon]
Location [Strand]53018..53653 [+]
Productconjugal transfer protein TrbN
Component typeTrbN
UniProt IDQ8RSI4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 211 a.a.     [Download]
>gi|19352397|ref|NP_598155.1| TrbN protein [uncultured bacterium]
MPFAADLPPQLQERVVCSISAAVKYEVPANIVLAVAEKEGGKPGQWVRNSNGTHDVGPMQFNTAYLRDLA
RYGITADDVAAAGCYSFDLAAWRLRMHIRNDKGDLWTKAANYHSRTPQYNAVYRADLMRKATKWADWLEA
RFVTLDVTKAGAVPSMPTGPAPAAQVAQQAPAAAPAAAPAARPAAAPSLNVAGGYVPRTISFNTRSEGSP
E
 
Nucleotide Sequence: 636 bp     [Download]
>gi|19352339|ref|NC_003430.1|:53018-53653 Uncultured bacterium plasmid pB4, complete sequence
ATGCCCTTTGCCGCTGACCTTCCGCCGCAGCTCCAGGAGCGCGTCGTGTGCTCGATCTCTGCCGCCGTGA
AGTACGAAGTGCCGGCAAACATCGTGCTCGCCGTCGCGGAGAAGGAAGGCGGCAAGCCGGGCCAGTGGGT
GCGCAACTCCAACGGCACCCATGACGTGGGGCCGATGCAGTTCAACACGGCGTACCTGCGCGACCTGGCG
CGCTACGGGATCACGGCGGACGATGTAGCGGCCGCAGGCTGCTACTCGTTCGACCTGGCCGCCTGGCGGT
TGCGGATGCACATTCGCAACGACAAGGGCGATCTCTGGACGAAGGCCGCGAACTATCACTCGCGCACGCC
GCAGTACAACGCGGTGTACCGCGCCGACCTGATGCGCAAGGCCACGAAGTGGGCCGATTGGCTCGAAGCC
CGGTTCGTCACGCTCGACGTGACGAAAGCCGGTGCGGTGCCCTCGATGCCGACCGGGCCAGCGCCGGCGG
CGCAAGTCGCCCAGCAGGCCCCGGCAGCAGCTCCAGCGGCCGCGCCGGCAGCGAGGCCGGCGGCGGCTCC
GTCCCTCAACGTCGCGGGCGGCTATGTGCCGCGCACGATCTCTTTCAACACCAGAAGCGAAGGCTCGCCG
GAGTAG
 Primer design