SecReT4
Protein ID: 19352410
T4SS name [ID]Trb [61]
Gene symboltraF
Locus tagpB4p71
Strainuncultured bacterium plasmid pB4 (NC_003430)
Repliconplasmid pB4 [GenBank: NC_003430] [Browse all T4SS(s) in this replicon]
Location [Strand]66649..67185 [-]
Productconjugal transfer peptidase TraF
Component typeTraF
UniProt IDQ8RSH3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1.1e-45, Aligned region: 32..177
Protein Sequence: 178 a.a.     [Download]
>gi|19352410|ref|NP_598168.1| TraF protein [uncultured bacterium]
MSRILKRITKGVAVAGLAALVLAAGSYAAGARINTTKSIPVGLYWTSSAPVEKGAYVLWCPPKVGVFDDA
KERGYIGAGFCPGDYGYMMKRVLAAKDDAVSVADDGVRVNGELLPHSKPIQADKSGRPLPRFQASTYTLG
NAELLLMSDVSDTSFDGRYFGPINRSQVQTVIRPVITW
 
Nucleotide Sequence: 537 bp     [Download]
>gi|19352339|ref|NC_003430.1|:c67185-66649 Uncultured bacterium plasmid pB4, complete sequence
ATGAGCCGCATCCTGAAACGCATCACGAAAGGCGTTGCCGTCGCCGGCCTGGCCGCCCTGGTGCTGGCCG
CCGGCAGCTATGCCGCCGGTGCCCGCATCAACACCACCAAGAGCATTCCGGTCGGCCTGTACTGGACGAG
CAGCGCGCCGGTGGAGAAGGGCGCTTACGTGCTTTGGTGCCCGCCGAAGGTCGGCGTGTTCGATGACGCC
AAGGAAAGGGGCTACATCGGGGCTGGGTTCTGCCCAGGCGACTACGGCTACATGATGAAGCGCGTTTTAG
CCGCTAAAGACGATGCCGTATCGGTGGCCGATGACGGCGTGCGGGTCAATGGCGAGCTGCTGCCGCACAG
CAAGCCCATCCAGGCCGACAAGTCCGGCCGGCCCTTGCCGCGCTTCCAGGCCAGCACCTACACGCTGGGC
AATGCCGAGCTGCTGCTTATGTCGGACGTGAGCGACACGTCTTTCGACGGCCGCTACTTCGGCCCGATCA
ACCGTTCTCAAGTTCAGACCGTGATCCGTCCGGTCATCACCTGGTAG
 Primer design