SecReT4
Protein ID: 19352411
T4SS name [ID]Trb [61]
Gene symboltraG
Locus tagpB4p72
Strainuncultured bacterium plasmid pB4 (NC_003430)
Repliconplasmid pB4 [GenBank: NC_003430] [Browse all T4SS(s) in this replicon]
Location [Strand]67182..69086 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDQ8RSH2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.3e-163, Aligned region: 121..618
TraG-D_C [PF12696], Evalue: 2.6e-32, Aligned region: 444..568
TrwB_AAD_bind [PF10412], Evalue: 1.4e-26, Aligned region: 177..568
Protein Sequence: 634 a.a.     [Download]
>gi|19352411|ref|NP_598169.1| TraG protein [uncultured bacterium]
MKIKMNNSVGPQVRSAKPKTPKLLPILGGVSLVGGLQAATQFFAYTFQYHASLGANLGHVYAPWSILNWS
AKWYSQYPDEIMRAGSIGMVTATVGLLGVAVAKVVTSNSSKANEYLHGSARWAEKKDIQAAGLLPRERNV
LEIVTGKDAPTATGVYVGGWQDKDGNFFYLRHSGPEHVLTYAPTRSGKGVGLVVPTLLSWGASSVITDLK
GELWALTAGWRQKHAKNKVLRFEPASSSGGVCWNPLDEIRVGTEAEVGDVQNLATLIVDPDGKGLDSHWQ
KTAFALLVGVILHALYKARNEGGTATLPSVDAMLADPNRDIGELWMEMTTYGHVDGQNHHAIGSAARDMM
DRPEEEAGSVLSTAKSYLALYRDPVVARNVSRSDFRIKDLMHSDDPVSLYIVTQPNDKARLRPLVRVMVN
MIVRLLADKMDFENGRPVAHYKHRLLMMLDEFPSLGKLEIMQESLAFVAGYGIKCYLICQDINQLRSRET
GYGHDESITSNCHVQNAYPPNRVETAEHLSRLTGQTTVVKEQITTSGRRTAAMLGQVSRTYQEVQRPLLT
PDECLRMPGPKKNDKGEIEEAGDMVIYVAGYPAIYGKQPLYFKDPVFQARASIPAPKATDRLRQVVEAGE
GITI
 
Nucleotide Sequence: 1905 bp     [Download]
>gi|19352339|ref|NC_003430.1|:c69086-67182 Uncultured bacterium plasmid pB4, complete sequence
ATGAAAATCAAGATGAACAACTCCGTGGGGCCGCAGGTTCGCAGCGCGAAGCCAAAGACCCCCAAGCTCT
TGCCGATCCTCGGCGGGGTATCCCTGGTCGGCGGCCTCCAGGCCGCGACACAGTTCTTCGCCTACACGTT
CCAGTATCACGCGAGCCTCGGGGCCAACCTTGGGCACGTGTACGCGCCCTGGTCGATCCTGAACTGGTCG
GCGAAGTGGTACAGCCAGTACCCCGACGAGATCATGCGAGCCGGCAGCATCGGCATGGTGACTGCCACCG
TGGGCCTGCTGGGCGTGGCCGTGGCGAAAGTCGTCACGTCCAACAGCTCGAAGGCGAACGAGTACCTGCA
CGGTTCGGCCCGCTGGGCCGAGAAGAAGGACATTCAGGCCGCCGGCCTGCTGCCGCGCGAGCGGAACGTC
CTGGAGATCGTCACCGGCAAGGACGCGCCCACCGCCACCGGCGTCTATGTCGGCGGCTGGCAGGACAAGG
ACGGCAATTTCTTCTACCTGCGGCACAGCGGCCCCGAGCACGTGCTGACCTATGCCCCTACCCGGAGCGG
CAAGGGCGTCGGCCTGGTGGTGCCGACCCTGCTTTCGTGGGGTGCAAGCAGCGTCATCACTGACTTGAAG
GGCGAGTTGTGGGCGCTGACCGCCGGCTGGCGGCAGAAGCACGCCAAGAACAAGGTGCTGCGCTTCGAGC
CGGCCAGCAGCTCGGGCGGCGTGTGCTGGAACCCGCTGGACGAAATCCGCGTCGGCACCGAGGCCGAAGT
CGGCGACGTGCAGAACCTAGCAACTTTGATAGTTGACCCGGACGGTAAGGGCCTGGATTCCCACTGGCAA
AAGACCGCCTTTGCGCTCCTGGTCGGCGTCATCCTGCACGCGCTCTACAAGGCCAGGAACGAGGGCGGCA
CGGCCACGCTGCCATCGGTCGATGCCATGCTGGCCGATCCGAACCGGGACATTGGCGAGCTATGGATGGA
AATGACCACCTACGGGCACGTGGACGGTCAGAACCACCATGCCATCGGCTCGGCCGCCCGCGACATGATG
GATCGGCCCGAGGAAGAAGCCGGATCGGTGCTGTCCACGGCCAAATCCTATCTGGCCCTGTACCGCGATC
CCGTTGTGGCGCGCAACGTGAGCCGGTCGGACTTCCGCATCAAAGACCTGATGCACTCCGACGACCCGGT
GAGCCTGTACATCGTCACCCAGCCGAACGACAAGGCCCGCCTGCGGCCGCTGGTGCGCGTCATGGTGAAC
ATGATCGTGCGCCTGCTGGCCGACAAGATGGACTTCGAGAACGGCCGGCCGGTGGCCCACTACAAGCACC
GGCTGCTGATGATGCTGGACGAGTTCCCGAGCCTCGGGAAGCTCGAAATCATGCAAGAGTCGCTGGCCTT
CGTCGCCGGCTATGGCATCAAGTGCTACTTGATTTGCCAGGACATTAACCAGCTCCGAAGCCGCGAGACG
GGCTATGGCCACGACGAAAGCATCACGTCGAACTGCCACGTGCAGAACGCCTACCCGCCCAACCGCGTCG
AGACAGCCGAACACCTGTCCCGACTGACCGGGCAGACCACCGTGGTGAAGGAGCAGATCACGACCAGCGG
CCGCCGCACGGCGGCGATGCTGGGCCAGGTGTCGCGCACCTACCAGGAAGTGCAGCGCCCCTTGCTGACG
CCCGATGAATGCCTGCGTATGCCGGGGCCGAAGAAGAACGACAAGGGCGAGATCGAGGAAGCCGGCGACA
TGGTGATCTACGTCGCGGGCTACCCCGCCATCTACGGCAAGCAGCCGCTGTACTTCAAAGACCCGGTGTT
TCAGGCGCGGGCCTCGATCCCCGCGCCGAAGGCCACCGACCGGCTGCGCCAGGTTGTCGAGGCAGGGGAG
GGCATCACGATATGA
 Primer design