SecReT4
Protein ID: 193782656
T4SS name [ID]VirB [196]
Gene symbolvirB7
Locus tagSMa1310
StrainSinorhizobium meliloti 1021
Repliconplasmid pSymA [GenBank: NC_003037] [Browse all T4SS(s) in this replicon]
Location [Strand]714950..715264 [-]
ProductVirB7-like protein
Component typeVirB7
UniProt IDQ92YZ9
KEGG IDsme:SMa1310
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 104 a.a.     [Download]
>gi|193782656|ref|NP_435959.2| VirB7-like protein [Sinorhizobium meliloti 1021]
MTLFARTRERLSRINQNVPLLCVAAILSGCASMTYPLPKCDGYSRRPLNRSMWQWEDNSNFKLKQSDARP
AASQSVATAYAGEGREFPAFAHLDIDASYRPCEG
 
Nucleotide Sequence: 315 bp     [Download]
>gi|16262453|ref|NC_003037.1|:c715264-714950 Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence
ATGACGCTTTTCGCACGAACAAGAGAAAGGCTTTCCAGGATTAATCAGAACGTTCCGCTGCTTTGCGTTG
CGGCGATCTTAAGCGGTTGCGCATCGATGACCTATCCGCTCCCGAAATGTGACGGCTATTCGCGCCGGCC
CCTCAATCGATCGATGTGGCAGTGGGAAGACAATAGCAACTTCAAGCTGAAACAGTCCGATGCGCGACCG
GCGGCCTCTCAGTCCGTCGCCACCGCTTATGCCGGCGAGGGCAGGGAATTTCCCGCCTTCGCACATCTCG
ACATCGACGCATCCTATCGTCCTTGCGAGGGTTGA
 Primer design