SecReT4
Protein ID: 194098632
T4SS name [ID]Tra_F [557]
Gene symbol-
Locus tagNGK_1069
StrainNeisseria gonorrhoeae NCCP11945
Repliconchromosome [GenBank: NC_011035] [Browse all T4SS(s) in this replicon]
Location [Strand]871018..871794 [-]
Productprotein TraF
Component typeTraF_F
UniProt IDB4RLQ9
KEGG IDngk:NGK_1069
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.3e-77, Aligned region: 23..248
Thioredoxin_2 [PF13098], Evalue: 2.6e-06, Aligned region: 157..245
Protein Sequence: 258 a.a.     [Download]
>gi|194098632|ref|YP_002001694.1| protein TraF [Neisseria gonorrhoeae NCCP11945]
MAVMLIFSLHASNLRAADDGMGWYDQDIWKNENRAFLWYPDAKKPKQAGQNRPQNTPVRNELAEFEMLQR
NLDESRKIAVMNPTPQNLKRYIELQEVVMNKSAAFADQWQRVIWQNPNLDYSQRGRPNNQLAQQQYDHNR
QQQKAGAIRKLAGENGIMFVFKSDCPYCHTMAPILKNFADQYGIKVMPVSLDGGGINHFPRALPNNGIAQ
RLNITTVPAMYVMDTKTKQFTPIGFGVMAQTTLEDRFLAYSRPVGTLY
 
Nucleotide Sequence: 777 bp     [Download]
>gi|194097589|ref|NC_011035.1|:c871794-871018 Neisseria gonorrhoeae NCCP11945 chromosome, complete genome
ATGGCCGTCATGCTGATATTTAGCCTGCACGCCTCCAATCTGCGAGCTGCGGATGATGGCATGGGATGGT
ATGACCAAGATATCTGGAAAAACGAAAACCGTGCTTTCTTATGGTATCCGGATGCTAAAAAGCCCAAACA
AGCCGGACAAAACCGGCCTCAAAATACTCCGGTTCGTAATGAACTTGCAGAATTTGAAATGCTGCAAAGA
AATTTGGATGAGTCGCGTAAAATTGCCGTCATGAACCCCACACCTCAAAATTTGAAGCGATATATTGAAC
TTCAAGAGGTTGTGATGAACAAATCTGCGGCATTTGCCGATCAATGGCAAAGGGTAATTTGGCAAAACCC
AAATTTGGATTACAGCCAGCGCGGTCGTCCGAACAACCAACTGGCCCAGCAACAATATGATCATAACCGT
CAGCAACAAAAGGCCGGGGCAATTAGAAAACTTGCCGGAGAGAACGGCATTATGTTTGTTTTCAAATCGG
ATTGCCCTTACTGTCATACCATGGCGCCGATTTTGAAAAACTTTGCCGACCAATACGGTATTAAGGTTAT
GCCGGTCAGTCTCGATGGCGGAGGTATTAATCACTTCCCGCGTGCTTTGCCGAACAACGGTATTGCCCAA
AGGTTGAATATTACTACTGTACCTGCAATGTACGTCATGGATACAAAAACCAAGCAATTTACACCCATTG
GATTTGGGGTGATGGCGCAAACCACGCTTGAGGATCGTTTCTTAGCGTATTCCCGCCCTGTCGGGACATT
GTATTAA
 Primer design