SecReT4
Protein ID: 194098647
T4SS name [ID]Tra_F [557]
Gene symbol-
Locus tagNGK_1084
StrainNeisseria gonorrhoeae NCCP11945
Repliconchromosome [GenBank: NC_011035] [Browse all T4SS(s) in this replicon]
Location [Strand]885313..885594 [-]
Productprotein TraL
Component typeTraL_F
UniProt IDB4RLS4
KEGG IDngk:NGK_1084
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 2.7e-30, Aligned region: 3..92
Protein Sequence: 93 a.a.     [Download]
>gi|194098647|ref|YP_002001709.1| protein TraL [Neisseria gonorrhoeae NCCP11945]
MRDYHVPVSIDDPKKAFIWDLDVFILFMSGFGIGIVSRHFFISMSISLFIAWRWGKLKSGKHQWFFLHVL
YWYLPINEKNKRIPETNKREFLN
 
Nucleotide Sequence: 282 bp     [Download]
>gi|194097589|ref|NC_011035.1|:c885594-885313 Neisseria gonorrhoeae NCCP11945 chromosome, complete genome
ATGAGAGATTATCATGTGCCGGTATCGATAGACGATCCCAAAAAGGCATTTATTTGGGACTTGGACGTTT
TTATATTATTTATGTCCGGCTTCGGTATAGGTATTGTCTCTCGTCACTTTTTCATTTCCATGTCAATTAG
CCTTTTCATTGCATGGAGGTGGGGCAAGCTTAAGTCTGGCAAGCATCAATGGTTTTTTTTGCATGTTCTT
TACTGGTACTTACCCATTAATGAAAAAAACAAACGGATACCTGAAACGAATAAACGGGAGTTTCTAAATT
GA
 Primer design