SecReT4
Protein ID: 194334517
T4SS name [ID]Trb [484]
Gene symbol-
Locus tagPaes_1712
StrainProsthecochloris aestuarii DSM 271
Repliconchromosome [GenBank: NC_011059] [Browse all T4SS(s) in this replicon]
Location [Strand]1871005..1871949 [-]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDB4S3J1
KEGG IDpaa:Paes_1712
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.5e-61, Aligned region: 94..313
Protein Sequence: 314 a.a.     [Download]
>gi|194334517|ref|YP_002016377.1| P-type conjugative transfer protein TrbG [Prosthecochloris aestuarii DSM 271]
MSKRYMVSSGLLALCMASSGCSQAAEGTFVEASPVADRMQVAAPEVAHSLLSENRLLRIPGDDERRPVAG
KPWEVIDAANRSAAQNPDSAGYFNAIMLYDYVPGSLFQVYAAPLRLTDIQLQPGEKIVGQPAAGDTVRWI
LGIGRSRIDGQEQQHVYVKATRPGLETTLVITTDRRTYHLELHSYRETYMAAVQWRYPQEELRVPGAGAG
EDVVASGVDIRQLNFGYDVDVRKGGRPSWMPLKVFDDGRKTFIQFPDSMLAGEAPVLFVVSREGDSQLVN
YRVKDEFFVVDRLFEEAELRIGRKRQNVVRISRL
 
Nucleotide Sequence: 945 bp     [Download]
>gi|194332853|ref|NC_011059.1|:c1871949-1871005 Prosthecochloris aestuarii DSM 271 chromosome, complete genome
ATGAGTAAAAGGTATATGGTTTCTTCTGGATTGCTTGCGCTGTGTATGGCGAGTTCGGGATGCAGTCAGG
CGGCTGAAGGGACATTTGTGGAGGCTTCTCCTGTTGCAGATCGGATGCAGGTGGCGGCGCCTGAGGTTGC
GCATTCTTTGCTATCGGAAAACAGGCTGCTGCGGATTCCTGGAGATGATGAGCGTCGGCCGGTAGCGGGT
AAGCCATGGGAGGTTATTGACGCGGCAAATCGTTCGGCTGCACAGAATCCCGATAGTGCGGGGTACTTTA
ATGCGATTATGCTCTATGATTATGTGCCTGGAAGTTTGTTTCAGGTGTATGCAGCTCCTTTGCGTTTGAC
CGATATTCAGTTGCAGCCGGGGGAGAAAATTGTGGGACAACCTGCTGCTGGTGATACGGTTCGCTGGATT
CTCGGAATCGGGCGCAGTAGAATTGATGGTCAGGAGCAGCAGCATGTGTATGTGAAAGCAACCAGACCGG
GATTGGAGACGACACTTGTGATTACGACGGACCGTCGGACCTATCATCTTGAGTTGCACAGTTATCGGGA
AACTTACATGGCTGCAGTGCAGTGGCGTTACCCGCAGGAGGAACTTCGCGTACCGGGAGCTGGGGCGGGG
GAAGATGTCGTTGCTTCCGGGGTGGATATCCGTCAACTGAATTTCGGGTATGATGTCGATGTTCGCAAGG
GAGGCCGTCCTTCGTGGATGCCGTTGAAGGTGTTTGATGATGGGCGCAAGACGTTTATTCAATTCCCTGA
TTCTATGTTGGCTGGTGAAGCGCCTGTGCTGTTTGTGGTGTCACGGGAGGGTGATTCGCAACTGGTGAAT
TATCGGGTTAAAGATGAGTTTTTTGTGGTTGACCGGTTGTTTGAGGAGGCGGAACTGCGCATTGGCAGGA
AACGCCAGAATGTGGTCAGGATCAGTCGCTTGTAG
 Primer design