SecReT4
Protein ID: 194334519
T4SS name [ID]Trb [484]
Gene symbol-
Locus tagPaes_1714
StrainProsthecochloris aestuarii DSM 271
Repliconchromosome [GenBank: NC_011059] [Browse all T4SS(s) in this replicon]
Location [Strand]1872667..1873896 [-]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDB4S3J3
KEGG IDpaa:Paes_1714
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.7e-33, Aligned region: 37..252
Protein Sequence: 409 a.a.     [Download]
>gi|194334519|ref|YP_002016379.1| P-type conjugative transfer protein TrbL [Prosthecochloris aestuarii DSM 271]
MHPGILTDTLNHFLDAFTASWGYLQPSINWLIGILLSIEILLLGLWWALSGGEQLVNVMKKLLFLGFWMW
LVTGFPYISHAFVSSLIEAGKIAGNSTGDGPSLFNPSKILWYGIDITKPLGAQLKKSGFNLVNAFVIALA
YLLIIIAYMIIAWQVFFAVLEYYLLMAVVSILLPFGFVEKTRFLAEKAISAVISSGIKLMVLAFILSVGE
PIIKGFDLPEGLWSFEEIWSILLVSGGIAFLAWNAPNVASGLLSGSPSLSANSAASQAGQAAMVAGAAVS
AGVAATGAAASVAGGAVKMASAATTGADIAGGAAAMGGAGPIGTAAARLKGGAEAVGKGVWNRTGGKVAD
FMKQHAAEGSKEGYVNTGGKLPKSSKSSEGPAWASAMIQSLQNARQESSRSAKGNGDNL
 
Nucleotide Sequence: 1230 bp     [Download]
>gi|194332853|ref|NC_011059.1|:c1873896-1872667 Prosthecochloris aestuarii DSM 271 chromosome, complete genome
ATGCATCCAGGTATTCTTACTGATACTCTTAATCATTTTCTTGATGCATTTACTGCGAGTTGGGGATATT
TACAACCATCGATTAATTGGTTGATAGGAATACTCCTTTCCATCGAAATTCTATTGTTAGGATTATGGTG
GGCATTGAGCGGTGGGGAGCAGCTTGTAAATGTCATGAAAAAGCTTCTCTTCTTAGGCTTTTGGATGTGG
TTGGTTACAGGTTTTCCATATATAAGTCACGCATTTGTTAGTTCGCTCATAGAGGCTGGAAAAATAGCTG
GGAATAGTACCGGTGATGGGCCTAGTTTATTTAATCCATCAAAAATACTTTGGTATGGCATTGATATAAC
CAAGCCTTTGGGAGCGCAATTAAAAAAATCAGGTTTTAATCTGGTAAATGCTTTTGTTATTGCTTTGGCG
TATTTGTTGATAATAATTGCATATATGATTATTGCGTGGCAAGTGTTTTTTGCTGTTTTAGAGTATTATT
TATTGATGGCGGTTGTAAGCATTTTGCTTCCCTTTGGTTTTGTTGAAAAAACAAGATTTTTGGCTGAAAA
AGCGATTTCAGCAGTTATTTCTTCAGGTATTAAATTAATGGTTTTGGCTTTTATTCTGTCTGTAGGTGAG
CCGATTATAAAGGGATTCGATTTGCCGGAGGGATTATGGTCTTTTGAGGAAATTTGGTCAATACTATTGG
TTTCCGGTGGTATTGCTTTCCTGGCATGGAATGCTCCTAATGTCGCATCAGGGTTGTTGTCTGGGAGTCC
GAGTTTGTCGGCTAATTCGGCGGCGAGTCAGGCGGGGCAGGCAGCTATGGTTGCGGGGGCTGCTGTGTCG
GCCGGGGTGGCGGCGACTGGTGCTGCGGCGTCGGTGGCGGGAGGGGCGGTCAAGATGGCTTCTGCTGCTA
CAACTGGTGCTGATATTGCTGGCGGGGCAGCGGCAATGGGTGGTGCCGGGCCGATTGGCACTGCTGCAGC
GAGGTTGAAAGGTGGTGCTGAGGCTGTTGGTAAGGGGGTCTGGAACCGGACTGGTGGTAAGGTGGCAGAT
TTTATGAAACAGCATGCTGCAGAAGGGTCGAAAGAAGGGTATGTGAATACCGGCGGAAAATTGCCGAAGA
GTTCGAAAAGTTCGGAGGGACCAGCGTGGGCTTCGGCTATGATACAGTCTTTGCAGAATGCCCGGCAGGA
GAGTTCCCGGTCGGCAAAGGGTAATGGCGATAATTTATAA
 Primer design