SecReT4
Protein ID: 194334524
T4SS name [ID]Trb [484]
Gene symbol-
Locus tagPaes_1719
StrainProsthecochloris aestuarii DSM 271
Repliconchromosome [GenBank: NC_011059] [Browse all T4SS(s) in this replicon]
Location [Strand]1877609..1877905 [-]
Productconjugal transfer protein Trbc
Component typeTrbC
UniProt IDB4S3J8
KEGG IDpaa:Paes_1719
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.2e-17, Aligned region: 4..86
Protein Sequence: 98 a.a.     [Download]
>gi|194334524|ref|YP_002016384.1| conjugal transfer protein Trbc [Prosthecochloris aestuarii DSM 271]
MKRTLLAIFFLFFANTLFGASTDMPWEGPLEKLLNSLTGPVSRVIGAVAIVSLGLGLAFSDGGSVMRKAL
WVVMGLAIAYNAVSWGLEFMGFGGGLSV
 
Nucleotide Sequence: 297 bp     [Download]
>gi|194332853|ref|NC_011059.1|:c1877905-1877609 Prosthecochloris aestuarii DSM 271 chromosome, complete genome
ATGAAGCGGACATTGTTGGCGATTTTTTTTCTTTTTTTCGCAAATACGCTCTTTGGTGCTTCAACCGATA
TGCCGTGGGAGGGCCCTCTTGAGAAGTTACTGAATTCATTGACTGGTCCTGTGTCGAGAGTGATCGGTGC
GGTGGCTATTGTGTCGCTTGGGCTCGGGCTGGCGTTTTCGGATGGGGGAAGCGTGATGCGTAAGGCGTTG
TGGGTGGTGATGGGGCTTGCGATAGCCTACAATGCGGTGAGCTGGGGTCTTGAATTTATGGGTTTTGGTG
GAGGACTGAGCGTATGA
 Primer design