SecReT4
Protein ID: 194334527
T4SS name [ID]Trb [484]
Gene symbol-
Locus tagPaes_1722
StrainProsthecochloris aestuarii DSM 271
Repliconchromosome [GenBank: NC_011059] [Browse all T4SS(s) in this replicon]
Location [Strand]1879734..1880237 [-]
Producthypothetical protein
Component typeTrbG
UniProt IDB4S3K1
KEGG IDpaa:Paes_1722
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.3e-16, Aligned region: 52..159
Protein Sequence: 167 a.a.     [Download]
>gi|194334527|ref|YP_002016387.1| hypothetical protein Paes_1722 [Prosthecochloris aestuarii DSM 271]
MNSKYSVSAMVAVFIFSAFSALSTYANDSAGKARYDGDVHVAAAESMGDDCEVMHYDYADQMYYDVYTAP
GSETVIQLEPGERIVQPVYLQSPENWDVSVKDVQQDGQFCQHVAVTCSECASRSIMEIATDRRSYIIDLN
SFEGSYMQVVKWNYLHETSHQTYAENR
 
Nucleotide Sequence: 504 bp     [Download]
>gi|194332853|ref|NC_011059.1|:c1880237-1879734 Prosthecochloris aestuarii DSM 271 chromosome, complete genome
ATGAATTCTAAATATTCTGTGTCGGCGATGGTTGCGGTGTTCATCTTTTCAGCTTTTTCTGCTCTGAGCA
CTTATGCCAATGATTCGGCTGGTAAGGCTCGCTATGATGGTGATGTTCATGTTGCTGCAGCAGAGTCTAT
GGGTGACGATTGTGAGGTGATGCATTATGATTATGCTGATCAAATGTACTATGATGTCTATACGGCACCG
GGATCCGAAACGGTTATTCAGCTTGAGCCGGGAGAAAGGATTGTCCAGCCGGTCTATCTGCAGAGTCCTG
AGAATTGGGATGTTTCGGTGAAGGATGTGCAGCAGGATGGACAGTTCTGCCAGCATGTTGCTGTAACGTG
TTCTGAATGTGCCAGCCGCAGTATTATGGAGATTGCGACGGACAGACGCTCTTATATTATTGATCTGAAC
AGTTTTGAAGGCTCGTACATGCAGGTTGTGAAGTGGAATTATCTGCATGAGACTTCTCATCAGACCTATG
CTGAGAACCGTTAA
 Primer design