SecReT4
Protein ID: 194335126
T4SS name [ID]Trb [307]
Gene symbol-
Locus tagPaes_2347
StrainProsthecochloris aestuarii DSM 271
Repliconplasmid pPAES01 [GenBank: NC_011061] [Browse all T4SS(s) in this replicon]
Location [Strand]8373..8675 [+]
ProductConjugal transfer protein TrbC
Component typeTrbC
UniProt IDB4S9L1
KEGG IDpaa:Paes_2347
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.8e-19, Aligned region: 3..88
Protein Sequence: 100 a.a.     [Download]
>gi|194335126|ref|YP_002019692.1| Conjugal transfer protein TrbC [Prosthecochloris aestuarii DSM 271]
MKKHVLLLPVLILLMSNAAYAASTGMPWEGPLDQLLNSLTGPVSRVIGAVSIISLGLGLAFSEGGGVMRK
ALWVVMGLAIAYNAVSWGIGFMGFGGGLLV
 
Nucleotide Sequence: 303 bp     [Download]
>gi|194335117|ref|NC_011061.1|:8373-8675 Prosthecochloris aestuarii DSM 271 plasmid pPAES01, complete sequence
ATGAAAAAACATGTCCTCCTTCTGCCGGTTCTGATATTGCTGATGTCGAATGCCGCATATGCAGCATCAA
CAGGTATGCCCTGGGAAGGTCCGCTTGACCAGCTCCTCAACTCGCTCACCGGCCCTGTTTCACGTGTCAT
CGGTGCTGTCTCCATTATTTCTCTTGGTCTTGGCCTTGCGTTTTCAGAAGGTGGAGGCGTCATGAGAAAA
GCGCTCTGGGTCGTCATGGGCCTTGCCATCGCCTACAATGCGGTAAGCTGGGGTATCGGGTTCATGGGAT
TTGGCGGAGGACTGCTGGTATGA
 Primer design