SecReT4
Protein ID: 194335131
T4SS name [ID]Trb [307]
Gene symbol-
Locus tagPaes_2352
StrainProsthecochloris aestuarii DSM 271
Repliconplasmid pPAES01 [GenBank: NC_011061] [Browse all T4SS(s) in this replicon]
Location [Strand]12401..13591 [+]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDB4S9L6
KEGG IDpaa:Paes_2352
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.1e-38, Aligned region: 36..252
Protein Sequence: 396 a.a.     [Download]
>gi|194335131|ref|YP_002019697.1| P-type conjugative transfer protein TrbL [Prosthecochloris aestuarii DSM 271]
MNTGILTSTLHTFIDAFNAGYAKLYPHIEWLIWVMLGIELVMLGLWWALGGGEQLAAVMKKLLYLLVWLW
IVQNFQTLAKTFVWSLAEAGEIAGGRTPDHKLLTDPTAIINIGLDISAPLADQVGREGWDIGNALAFSLM
WLMSALAFLIMGWQMFYALLEFYILITLVGILLPFGFFEPTKFMAEKSIGAVISSGVKLMVLSFIIAISH
TILTSLPIPSGFIDLETGLTIVLISGAIAFLAWNAPGIAAGLVVGSPSLSAATGAQNALAAGLAGGGALV
ATAAAGKFAATKVASLAGKFGSVSTKSGQMASLAKAGGVGGIDGPGGPSQMGATPGGSPGGSPSGTPSGG
SSSSGEDRNKSSGKKNPPKWAQQALQASRHIPEEARPSGGDSSPKL
 
Nucleotide Sequence: 1191 bp     [Download]
>gi|194335117|ref|NC_011061.1|:12401-13591 Prosthecochloris aestuarii DSM 271 plasmid pPAES01, complete sequence
ATGAATACAGGCATCCTGACAAGTACCCTGCATACCTTCATTGATGCTTTTAATGCAGGTTACGCAAAAC
TATACCCTCATATCGAATGGCTTATATGGGTTATGCTCGGTATAGAGCTCGTAATGCTCGGTCTTTGGTG
GGCTCTTGGTGGTGGTGAACAGTTGGCTGCTGTGATGAAGAAGCTGCTCTATTTGCTTGTATGGCTGTGG
ATTGTTCAGAATTTTCAGACGCTAGCAAAAACTTTTGTTTGGTCACTTGCTGAGGCTGGTGAAATAGCTG
GAGGAAGAACGCCTGATCACAAACTCCTTACTGACCCTACTGCTATCATCAATATTGGCCTGGATATTTC
AGCCCCATTGGCTGATCAGGTTGGTAGAGAAGGGTGGGATATCGGAAATGCGCTAGCCTTCTCCCTGATG
TGGTTGATGTCTGCGCTTGCATTTCTGATCATGGGTTGGCAGATGTTCTATGCGTTATTGGAGTTTTACA
TCCTAATTACACTTGTTGGAATCCTATTGCCTTTTGGTTTTTTCGAACCAACAAAATTCATGGCTGAAAA
ATCGATTGGGGCTGTGATATCGTCTGGCGTAAAGTTGATGGTGCTCTCCTTTATCATTGCTATCAGTCAT
ACAATTTTAACCTCACTGCCTATTCCTAGTGGCTTTATTGATCTTGAAACAGGGTTAACCATCGTATTGA
TCAGCGGAGCCATAGCATTCCTTGCCTGGAATGCGCCAGGTATTGCTGCAGGTCTCGTTGTGGGAAGTCC
GTCACTGTCGGCTGCAACAGGCGCACAAAACGCTCTGGCTGCCGGGCTGGCGGGTGGCGGTGCTCTTGTG
GCGACCGCAGCAGCCGGGAAGTTTGCAGCTACCAAAGTAGCTAGTCTTGCTGGCAAATTCGGCAGTGTGA
GCACTAAATCAGGCCAGATGGCATCTCTTGCCAAAGCTGGTGGAGTTGGTGGTATCGATGGACCAGGAGG
GCCTTCGCAGATGGGTGCCACTCCGGGTGGTTCTCCCGGTGGTTCCCCTTCCGGAACGCCTTCAGGCGGT
TCATCGTCATCCGGAGAAGACAGGAACAAGTCATCCGGAAAAAAGAACCCGCCAAAGTGGGCCCAGCAGG
CACTGCAGGCTTCACGGCATATACCTGAAGAAGCAAGGCCGTCGGGAGGAGACAGCAGTCCCAAACTGTA
A
 Primer design