SecReT4
Protein ID: 194335133
T4SS name [ID]Trb [307]
Gene symbol-
Locus tagPaes_2354
StrainProsthecochloris aestuarii DSM 271
Repliconplasmid pPAES01 [GenBank: NC_011061] [Browse all T4SS(s) in this replicon]
Location [Strand]14328..15266 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDB4S9L8
KEGG IDpaa:Paes_2354
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.7e-65, Aligned region: 93..311
Protein Sequence: 312 a.a.     [Download]
>gi|194335133|ref|YP_002019699.1| P-type conjugative transfer protein TrbG [Prosthecochloris aestuarii DSM 271]
MRRRHLLTLLITASVLQLGGCTQSTTGTMLEASLEPEQPAPEVRITPTPLAQNRQQPLPKPDHPEQQNHR
PWLVIEQANASSAQNPDSHGYFNAIMTYDYTEGYLYQVYTAPLRLTDIQLQPGEKIVGTPAAGDTVRWVV
GVGRSIKDGKEQQHIYVKPTKPGLQTTLIVTTDRRTYHIELHSYRETYMASVAWSYPHDDLREQISQIRS
TTDPQVDISKLNFDYTVRVKNGRQPAWLPVKVFDDGTKTFIQFSRDMLVREAPALFVLGEEGSAQLVNYR
MKNNYYIVDRLFDRAELRLGENNQNIVRIVRR
 
Nucleotide Sequence: 939 bp     [Download]
>gi|194335117|ref|NC_011061.1|:14328-15266 Prosthecochloris aestuarii DSM 271 plasmid pPAES01, complete sequence
ATGAGACGACGACACCTTCTGACACTACTGATTACCGCCTCGGTCCTGCAACTGGGTGGATGCACCCAGT
CCACAACCGGCACCATGCTTGAAGCCAGTCTCGAGCCCGAACAGCCCGCCCCAGAGGTGCGGATCACACC
GACGCCGCTGGCACAGAACAGGCAGCAGCCCCTCCCGAAGCCAGATCATCCGGAGCAGCAGAACCACAGG
CCATGGCTGGTCATCGAGCAGGCCAACGCATCATCGGCCCAGAATCCCGACAGCCACGGGTACTTCAACG
CCATCATGACCTACGACTACACCGAAGGCTACCTCTACCAGGTCTACACCGCACCGCTGAGGCTTACCGA
CATCCAGCTGCAGCCAGGCGAGAAGATCGTCGGCACACCGGCAGCCGGAGACACCGTCCGCTGGGTGGTC
GGCGTAGGGAGGAGCATAAAGGACGGAAAGGAGCAGCAGCATATCTACGTCAAGCCTACAAAGCCCGGAC
TGCAGACCACCCTGATCGTCACCACCGACCGCAGGACCTACCACATCGAACTGCACAGCTACCGCGAAAC
CTACATGGCCTCCGTCGCGTGGAGCTACCCTCACGACGATCTCCGGGAGCAGATATCGCAGATCCGTTCA
ACCACCGATCCGCAGGTCGATATCTCGAAGCTCAACTTCGACTACACAGTGAGGGTAAAGAACGGGAGAC
AACCCGCATGGCTGCCCGTCAAGGTGTTTGATGACGGCACAAAGACCTTCATCCAGTTCTCCCGTGACAT
GCTCGTGCGCGAGGCACCGGCACTGTTCGTGCTGGGAGAGGAAGGTTCGGCCCAGCTGGTCAACTACCGC
ATGAAAAACAACTACTACATCGTCGACAGGCTCTTTGATCGGGCAGAGCTGCGCCTCGGAGAGAACAACC
AGAACATTGTGCGCATCGTGCGACGCTAA
 Primer design