SecReT4
Protein ID: 194366215
T4SS name [ID]VirB [403]
Gene symbol-
Locus tagSmal_2439
StrainStenotrophomonas maltophilia R551-3
Repliconchromosome [GenBank: NC_011071] [Browse all T4SS(s) in this replicon]
Location [Strand]2743048..2744208 [-]
ProductTrbL/VirB6 plasmid conjugal transfer protein
Component typeVirB6
UniProt IDB4SNB7
KEGG IDsmt:Smal_2439
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.9e-30, Aligned region: 67..301
Protein Sequence: 386 a.a.     [Download]
>gi|194366215|ref|YP_002028825.1| TrbL/VirB6 plasmid conjugal transfer protein [Stenotrophomonas maltophilia R551-3]
MDLGLMDGMSGQGPLHMLQNLHASSSIGDFVFFRLILDYLHKEIAEYGVKLLGRMMAWVGGIALTLMTLW
VLIQGFRIATGRSRDSMMVLVTNMAKAALIVSVATTMGMFGREMHGFLINDVKNEITYVVTGKKDSPEDL
IDENLGYMQLALSSVDALDVMSDVTLDNAKTRAMWFIGMGTGGPAVTAGSMLLLYEVALALFIGLGPLFI
LCLLFDQTKQLFQKWLLYGIGTMFSMAVLAAMTGIAMKMVSKVAFAFWGSTLTGTLMGQNFSEGMSSMAL
QQGGMGLILTTLILTAPPMAAMFFQGTLGSFMAYSQIGGSAVPASPGPNGQPPGSTGGQSYRPQAPAGEG
GGSPMGMQVANPRLHVGPDSATHSPGLRGNAGTGVA
 
Nucleotide Sequence: 1161 bp     [Download]
>gi|194363778|ref|NC_011071.1|:c2744208-2743048 Stenotrophomonas maltophilia R551-3 chromosome, complete genome
ATGGATCTTGGGCTGATGGATGGCATGTCGGGGCAAGGCCCCCTGCACATGCTGCAGAATCTGCACGCGT
CATCCTCAATTGGTGACTTTGTGTTCTTCCGGCTGATCCTCGATTACCTGCATAAGGAAATCGCGGAGTA
CGGCGTAAAGCTGCTTGGACGCATGATGGCGTGGGTCGGTGGCATTGCACTGACTCTCATGACGCTCTGG
GTGCTGATTCAGGGTTTCCGGATCGCCACCGGTCGCAGCCGCGATTCGATGATGGTGCTCGTGACCAACA
TGGCCAAGGCCGCGCTGATCGTGTCGGTTGCCACGACCATGGGTATGTTCGGTCGCGAGATGCATGGCTT
TCTCATCAATGACGTGAAGAACGAGATCACTTACGTCGTGACCGGGAAGAAGGACTCACCGGAGGATCTG
ATCGATGAGAACCTGGGCTACATGCAGCTGGCGCTATCCAGCGTTGACGCGCTGGACGTGATGAGCGACG
TGACGCTGGACAACGCGAAGACCCGTGCCATGTGGTTCATTGGCATGGGCACGGGTGGTCCAGCAGTCAC
AGCTGGCTCAATGCTTTTGCTGTATGAGGTCGCGCTGGCGTTGTTCATCGGCCTGGGGCCATTGTTCATC
CTGTGCTTGCTGTTTGACCAGACCAAGCAGCTGTTCCAGAAGTGGCTGCTCTACGGCATAGGCACGATGT
TCTCCATGGCGGTTCTGGCAGCGATGACCGGCATCGCGATGAAGATGGTGTCCAAGGTTGCGTTCGCCTT
CTGGGGAAGCACGTTGACGGGCACGCTGATGGGTCAGAATTTCAGTGAAGGTATGTCGAGCATGGCACTG
CAGCAAGGCGGCATGGGCCTGATCCTGACCACGCTGATTCTGACTGCGCCCCCAATGGCGGCGATGTTCT
TCCAGGGAACATTGGGCAGCTTCATGGCATATTCGCAGATAGGCGGCAGCGCAGTACCGGCATCGCCGGG
CCCGAATGGTCAGCCGCCGGGTTCGACGGGCGGGCAGAGTTACAGGCCCCAAGCCCCCGCGGGAGAAGGT
GGAGGTTCACCCATGGGAATGCAGGTAGCGAACCCTAGGTTGCACGTCGGCCCGGATTCCGCGACACATT
CTCCAGGCCTTAGGGGTAACGCTGGTACGGGTGTAGCTTGA
 Primer design