SecReT4
Protein ID: 194366217
T4SS name [ID]VirB [403]
Gene symbol-
Locus tagSmal_2441
StrainStenotrophomonas maltophilia R551-3
Repliconchromosome [GenBank: NC_011071] [Browse all T4SS(s) in this replicon]
Location [Strand]2745103..2747550 [-]
Producttype IV secretion/conjugal transfer ATPase
Component typeVirB4
UniProt IDB4SNB9
KEGG IDsmt:Smal_2441
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 5.6e-55, Aligned region: 171..376
AAA_10 [PF12846], Evalue: 2.6e-33, Aligned region: 439..718
Protein Sequence: 815 a.a.     [Download]
>gi|194366217|ref|YP_002028827.1| type IV secretion/conjugal transfer ATPase [Stenotrophomonas maltophilia R551-3]
MFSPDTSISEFIPLSSHVAPNVVKTTGGDYLLTWHLEGLPFVGREEWELEHRHNTFNRLLQTLRAPDFVN
VAFWVHDIRRRRTLKGKSNYKQRFNQDVSDQYMGMLSSQRIMQNELYLTMIYRPVVAGKRFVEKSANVEK
LRAEQEQAVEKLMELAGNVEAVIRDYAPYRLGMYEAKNGVVFSETLELFGYLINRIDEPVPVLSAPIKDY
LPVSRHMFSAKTGDFAINTPNGANHFGAILNIKEYAEGTYPGILNGLKYLDYEYVITHSFSPMGRQDALK
VLDRTKGMMISSGDKAVSQIVELDQAMDQLSSGNFVLGEYHFIMAVYGDTQAKLSQNVASTRAELSNAGF
VSTKEDLAVTSSFYSQLPGNWRYRTRLANVSSLNFLGLSPLHNFATGKQHNNPWGDCVTTLQTTNGQPYY
FNFHATHPSENSLGEKAIANTMVIGKSGTGKTALINFLLSQVQKYEPSPTIFFFDKDRGAEIFVRACGGN
YLALENGAPTGFNPFQCENNEANVQFLADLIKVLAGKREYSAREEEDIYRAVESMLDTPMHLRSMTNFQK
SLPNMGDDGLYARMRRWTSGNSLGWVFDNPVDTVDLSKANIIGFDYTDIIDNPEVRVPVINYLLHRLESL
IDGRPLIYVMDEFWKILDGEGGLKEFAKNKQKTIRKQNGLGIFATQSPEDALKSDISAALIEQTATLILL
PNPNASKSDYMDGLKLTEAEFNVVTALDERSRCFLVKQGHASSVCQLNLRGMDDILSVISASTDNIDIMH
RVLQTAAVRARVTVDELTPEQWLEDFYKNRKGSGKPASNSKEVAA
 
Nucleotide Sequence: 2448 bp     [Download]
>gi|194363778|ref|NC_011071.1|:c2747550-2745103 Stenotrophomonas maltophilia R551-3 chromosome, complete genome
ATGTTCAGCCCTGACACCTCCATCAGTGAGTTCATTCCGTTGTCGTCGCATGTTGCCCCGAACGTGGTCA
AGACCACGGGCGGTGACTATCTGCTGACCTGGCATCTGGAAGGGCTGCCTTTCGTCGGCCGCGAGGAGTG
GGAGCTCGAGCATCGTCACAACACGTTCAACCGTCTGCTGCAGACATTGCGCGCACCCGACTTCGTCAAC
GTTGCCTTCTGGGTGCATGACATCCGTCGTCGCCGCACGTTGAAGGGCAAGAGCAACTACAAGCAGCGCT
TCAACCAGGACGTGTCAGATCAGTACATGGGCATGCTGTCCTCGCAGCGCATCATGCAGAACGAGCTGTA
CCTGACCATGATCTATCGCCCGGTGGTGGCGGGTAAACGCTTCGTCGAAAAGTCGGCGAACGTGGAGAAG
CTCCGCGCCGAGCAGGAGCAGGCGGTCGAGAAGCTGATGGAACTGGCCGGCAACGTCGAGGCCGTGATCC
GCGACTACGCGCCGTATCGCCTGGGCATGTACGAAGCCAAGAACGGTGTGGTGTTCTCGGAAACGCTGGA
GCTGTTCGGCTACCTGATCAATCGCATCGATGAGCCGGTGCCGGTGCTGTCGGCGCCGATCAAGGATTAC
CTGCCTGTCAGCCGCCACATGTTCTCGGCCAAGACCGGCGATTTTGCGATCAACACCCCCAATGGCGCCA
ACCATTTTGGCGCCATCCTGAACATCAAGGAGTATGCCGAGGGGACCTACCCGGGCATCCTCAACGGCCT
GAAGTACCTGGATTACGAGTACGTCATCACCCATTCGTTCAGCCCGATGGGGCGTCAGGATGCGCTGAAG
GTGCTCGACCGCACCAAGGGCATGATGATCTCCTCCGGCGACAAGGCGGTCAGCCAGATCGTCGAGCTGG
ACCAGGCCATGGATCAGCTGTCGTCGGGCAACTTCGTGCTGGGTGAATACCACTTCATCATGGCGGTCTA
CGGCGACACGCAGGCCAAGCTTTCGCAGAACGTCGCCTCGACCCGTGCCGAGCTGTCAAACGCCGGATTC
GTGTCGACCAAGGAAGACCTGGCGGTTACCTCGTCCTTCTATTCGCAGCTGCCGGGTAACTGGCGCTACC
GCACTCGCCTGGCCAATGTCAGTTCGCTGAACTTCCTGGGCCTGTCGCCGCTGCACAACTTCGCCACCGG
CAAGCAGCACAACAATCCGTGGGGCGACTGCGTCACCACGCTGCAGACCACCAACGGCCAGCCGTACTAC
TTCAATTTCCACGCGACCCATCCGTCGGAAAACTCGCTGGGCGAGAAGGCGATCGCCAACACCATGGTGA
TCGGCAAGTCCGGTACCGGTAAGACCGCGCTGATCAACTTCCTGCTCAGCCAGGTGCAGAAGTACGAGCC
GTCGCCGACCATCTTCTTCTTCGACAAGGACCGCGGTGCTGAGATCTTCGTGCGGGCCTGCGGAGGTAAC
TATCTGGCCCTGGAGAACGGCGCGCCGACCGGCTTCAACCCGTTCCAGTGCGAGAACAACGAAGCCAACG
TGCAGTTCCTGGCCGACCTGATCAAGGTGCTGGCCGGCAAGCGCGAGTACAGCGCCCGCGAGGAAGAAGA
CATCTACCGCGCCGTGGAAAGCATGCTCGATACGCCGATGCATCTGCGCAGCATGACCAACTTCCAGAAG
AGCCTGCCCAACATGGGCGACGATGGCCTCTACGCGCGCATGCGCCGTTGGACCTCGGGCAATTCGCTGG
GCTGGGTGTTCGACAATCCCGTGGATACCGTTGACCTGAGCAAGGCCAACATCATCGGCTTCGACTACAC
CGACATCATCGACAACCCTGAAGTGCGCGTGCCGGTCATTAATTACCTGCTGCACCGCCTGGAGTCGCTG
ATCGACGGCCGTCCACTGATCTATGTGATGGACGAGTTCTGGAAGATCCTGGATGGCGAGGGTGGCCTGA
AGGAGTTCGCGAAGAACAAGCAGAAGACCATCCGTAAGCAGAATGGTCTCGGCATCTTTGCCACACAGAG
CCCGGAGGACGCGCTGAAGAGTGATATCTCCGCCGCCCTGATCGAGCAGACCGCTACCCTGATCCTGCTG
CCGAACCCGAATGCCAGCAAGAGCGACTACATGGATGGCCTGAAGTTGACCGAGGCCGAGTTCAATGTGG
TTACCGCCTTGGACGAGCGCTCGCGTTGCTTCCTGGTCAAGCAGGGTCATGCGTCCAGTGTCTGCCAGCT
CAACCTGCGCGGCATGGACGACATCCTGTCGGTGATCTCGGCGTCGACCGACAACATCGACATCATGCAT
CGTGTCCTGCAGACCGCCGCCGTGCGTGCACGTGTGACGGTGGATGAGCTGACGCCGGAACAGTGGCTGG
AAGATTTCTACAAGAACCGCAAGGGCTCCGGAAAGCCCGCATCCAACAGTAAGGAGGTTGCAGCATGA
 Primer design