SecReT4
Protein ID: 194366218
T4SS name [ID]VirB [403]
Gene symbol-
Locus tagSmal_2442
StrainStenotrophomonas maltophilia R551-3
Repliconchromosome [GenBank: NC_011071] [Browse all T4SS(s) in this replicon]
Location [Strand]2747632..2747940 [-]
Producttype IV secretory pathway VirB3 family protein
Component typeVirB3
UniProt IDB4SNC0
KEGG IDsmt:Smal_2442
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 9.7e-16, Aligned region: 4..79
Protein Sequence: 102 a.a.     [Download]
>gi|194366218|ref|YP_002028828.1| type IV secretory pathway VirB3 family protein [Stenotrophomonas maltophilia R551-3]
MHKNVVFRGCTRPAMFLGVPYLPFFMVAGGLLLLSMYTNFWFLLTIPVAVFIMRHMAKRDEMIFRLLGLR
LMFKLKVRNVQEHDGMWVLNPNHYRNKPARMD
 
Nucleotide Sequence: 309 bp     [Download]
>gi|194363778|ref|NC_011071.1|:c2747940-2747632 Stenotrophomonas maltophilia R551-3 chromosome, complete genome
GTGCATAAGAATGTCGTGTTCCGCGGCTGCACGCGTCCAGCGATGTTCCTGGGCGTGCCCTACCTGCCAT
TCTTCATGGTGGCAGGCGGGCTGTTGCTGCTCAGCATGTACACGAACTTCTGGTTCCTGCTCACCATTCC
GGTGGCGGTCTTCATCATGCGGCACATGGCCAAGCGTGACGAAATGATCTTCCGGCTGCTGGGCCTGCGC
CTGATGTTCAAGCTGAAGGTGCGCAACGTGCAGGAGCACGATGGCATGTGGGTGCTCAACCCCAACCATT
ACCGCAACAAGCCGGCCCGAATGGATTGA
 Primer design