SecReT4
Protein ID: 194366219
T4SS name [ID]VirB [403]
Gene symbol-
Locus tagSmal_2443
StrainStenotrophomonas maltophilia R551-3
Repliconchromosome [GenBank: NC_011071] [Browse all T4SS(s) in this replicon]
Location [Strand]2747933..2748343 [-]
Productconjugal transfer protein Trbc
Component typeVirB2
UniProt IDB4SNC1
KEGG IDsmt:Smal_2443
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 8.6e-15, Aligned region: 9..107
Protein Sequence: 136 a.a.     [Download]
>gi|194366219|ref|YP_002028829.1| conjugal transfer protein Trbc [Stenotrophomonas maltophilia R551-3]
MKRSNLDLVQAQRTLKTLLMATIFVGAMFAPQVFATNTDFGGTDKKVCGFFSNINGLLNMASIAVVTIAV
IFAGYQIAFAHKRIGDVAPILIGGVLIGAAGQIARMLLGEGSDGKCGAGTSTTYYLINNAIQYYRA
 
Nucleotide Sequence: 411 bp     [Download]
>gi|194363778|ref|NC_011071.1|:c2748343-2747933 Stenotrophomonas maltophilia R551-3 chromosome, complete genome
ATGAAGCGATCCAATCTCGACCTCGTCCAGGCCCAGCGCACGCTGAAGACCCTGCTGATGGCCACGATCT
TCGTCGGTGCCATGTTCGCCCCGCAGGTGTTCGCCACCAACACCGACTTCGGCGGCACCGACAAGAAGGT
CTGCGGTTTCTTCTCCAACATCAACGGCCTGCTGAACATGGCCTCGATCGCCGTGGTGACCATTGCGGTG
ATCTTCGCCGGCTACCAGATCGCTTTTGCGCACAAGCGCATCGGTGACGTCGCGCCGATCCTGATCGGTG
GCGTGCTGATCGGTGCCGCCGGCCAGATTGCGCGCATGCTGCTGGGTGAAGGCAGCGACGGCAAGTGCGG
TGCTGGCACCAGCACCACCTACTACCTGATCAACAACGCGATCCAGTACTACCGTGCATAA
 Primer design