SecReT4
Protein ID: 194366220
T4SS name [ID]VirB [403]
Gene symbol-
Locus tagSmal_2444
StrainStenotrophomonas maltophilia R551-3
Repliconchromosome [GenBank: NC_011071] [Browse all T4SS(s) in this replicon]
Location [Strand]2748417..2749400 [-]
ProductLytic transglycosylase
Component typeVirB1
UniProt IDB4SNC2
KEGG IDsmt:Smal_2444
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 2.1e-14, Aligned region: 15..138
Protein Sequence: 327 a.a.     [Download]
>gi|194366220|ref|YP_002028830.1| Lytic transglycosylase [Stenotrophomonas maltophilia R551-3]
MLPGLEMMACPEMAVSMDVMQHVINVESSRNPYAIGVVGGALVRQPKALDEALATVRMLEEKGYNFSIGL
AQVNRYNLGKYGLDSYEKAFQQCPNLQAGSRILADCYKRSGGDWGKSFSCYYSGNFETGFRHGYVQKVYD
SMRRGQQLATNGVAPIDVVSRGERRSVKVEHHPQLASPAQARIVAQSNGPVYVPSEDPARAYVVYPSTGA
MARGSLLNIADQALSKVVLGSVDRMMQPQPQPTQGATYPQQQAGGMPQQLPQPGPAQAMAMPQQLPGAAG
AGNEGPVMLRPWSERNQPVAGGENSFNAPVQAAPVQQIPAGDAAFVF
 
Nucleotide Sequence: 984 bp     [Download]
>gi|194363778|ref|NC_011071.1|:c2749400-2748417 Stenotrophomonas maltophilia R551-3 chromosome, complete genome
ATGCTGCCAGGACTGGAAATGATGGCGTGCCCGGAGATGGCCGTCTCGATGGACGTGATGCAGCACGTCA
TCAACGTGGAATCGTCGCGCAACCCCTATGCCATCGGCGTGGTCGGCGGCGCCCTGGTGCGCCAGCCCAA
GGCCCTCGACGAGGCGCTGGCCACCGTTCGCATGCTGGAGGAGAAGGGCTACAACTTCTCCATTGGCCTG
GCCCAGGTCAACCGTTACAACCTGGGCAAGTACGGGCTGGATTCCTACGAGAAGGCCTTCCAGCAGTGCC
CGAACCTGCAGGCTGGTTCGCGCATCCTCGCCGATTGCTACAAGCGCTCCGGTGGTGACTGGGGCAAGTC
GTTCAGCTGCTACTACTCGGGAAATTTCGAGACCGGCTTCCGCCATGGCTATGTGCAGAAGGTCTACGAC
TCGATGCGCCGCGGGCAGCAGCTTGCCACCAATGGTGTTGCGCCGATCGACGTGGTGAGTCGCGGTGAAC
GCCGCAGCGTGAAGGTCGAGCATCATCCGCAGCTGGCCTCTCCGGCGCAGGCCCGCATCGTTGCGCAGTC
CAATGGCCCGGTGTACGTGCCGTCGGAAGACCCGGCACGTGCGTATGTCGTGTATCCCTCCACCGGTGCG
ATGGCGCGGGGCAGCCTGCTGAACATCGCCGACCAGGCGCTGTCCAAGGTAGTGCTGGGTTCGGTGGACC
GGATGATGCAGCCACAGCCGCAGCCCACCCAAGGGGCCACGTATCCGCAGCAACAGGCCGGTGGCATGCC
GCAGCAGCTGCCTCAGCCGGGTCCGGCGCAGGCAATGGCCATGCCGCAGCAGTTGCCGGGCGCTGCCGGC
GCCGGCAACGAGGGGCCCGTGATGCTGCGCCCTTGGAGCGAGCGCAATCAGCCTGTGGCCGGTGGCGAAA
ATTCATTCAACGCACCGGTGCAGGCTGCACCGGTGCAGCAGATTCCCGCAGGGGATGCGGCCTTCGTGTT
CTGA
 Primer design