SecReT4
Protein ID: 194366221
T4SS name [ID]VirB [403]
Gene symbol-
Locus tagSmal_2445
StrainStenotrophomonas maltophilia R551-3
Repliconchromosome [GenBank: NC_011071] [Browse all T4SS(s) in this replicon]
Location [Strand]2749404..2750447 [-]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDB4SNC3
KEGG IDsmt:Smal_2445
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.6e-62, Aligned region: 27..325
Protein Sequence: 347 a.a.     [Download]
>gi|194366221|ref|YP_002028831.1| P-type DNA transfer ATPase VirB11 [Stenotrophomonas maltophilia R551-3]
MDAEVSPLALVSSDFLRYQYEVLGIAEYMTSPEVTEICINRPGELYLETRAGWQRVDVPSLTFERARQFC
TAVVNESNTGQRITDADPVVSLTFPTGQRAQFVIPPACDAGKVSITIRLPSKHTKSLSQYHEDGFFNQIL
ESDGSISEQDRELLELRQQREYAEFFRRAVMYRKNIVVSGATGSGKTTFMKALVNHIPDNERLVTIEDAR
ELFLTQPNVVHLLYSKGGQSTSNVSAKSCMEACLRMKPERIILAELRGDEAFYFIRNCASGHPGSITSCH
AGSPEQTWDQLALMVKASAEGSGLEFNVIKRLLMMTIDIVVHIKAHAGSRYITGIDFNPGRAQGQEG
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|194363778|ref|NC_011071.1|:c2750447-2749404 Stenotrophomonas maltophilia R551-3 chromosome, complete genome
ATGGACGCCGAAGTGTCACCCCTCGCCCTCGTCTCCAGCGATTTCCTGCGCTATCAGTACGAAGTGCTGG
GCATCGCCGAGTACATGACTTCCCCGGAAGTGACGGAAATCTGCATCAACCGTCCCGGTGAGCTGTACCT
GGAAACCCGGGCGGGGTGGCAGCGGGTAGACGTGCCGAGCCTGACCTTCGAGCGGGCCCGGCAGTTCTGC
ACGGCGGTGGTGAACGAGAGCAACACCGGCCAACGCATCACCGATGCTGATCCAGTGGTCTCGCTCACGT
TCCCCACCGGCCAGCGTGCGCAGTTCGTGATTCCGCCGGCGTGCGATGCAGGGAAGGTGTCGATCACCAT
CCGCCTGCCTTCCAAGCACACCAAGTCGCTCAGCCAGTATCACGAAGATGGGTTCTTCAACCAGATTCTG
GAAAGCGATGGCAGCATCAGCGAGCAGGATCGCGAACTGCTGGAGCTGCGTCAGCAGCGCGAGTACGCCG
AGTTCTTCCGGCGTGCGGTGATGTACCGCAAGAACATCGTGGTGTCCGGTGCGACCGGTAGCGGCAAGAC
CACCTTCATGAAAGCGCTGGTCAATCATATCCCGGACAACGAGCGCCTGGTCACGATCGAGGACGCACGC
GAGCTGTTTCTGACCCAACCCAATGTGGTGCACCTGCTGTACTCCAAGGGAGGGCAGAGCACCAGCAATG
TCAGCGCAAAGAGTTGCATGGAAGCCTGCCTGCGCATGAAGCCAGAACGCATCATCCTGGCCGAGCTGCG
CGGTGACGAGGCGTTCTACTTCATCCGCAACTGCGCATCGGGCCACCCGGGCTCGATCACCAGTTGCCAT
GCCGGTAGCCCGGAGCAGACCTGGGATCAGCTGGCGCTGATGGTGAAGGCCTCGGCCGAGGGTTCGGGCC
TGGAGTTCAACGTGATCAAGCGACTGTTGATGATGACCATCGACATCGTCGTGCATATCAAGGCGCATGC
CGGCTCGCGCTACATCACCGGCATCGACTTCAATCCTGGGCGTGCCCAGGGGCAGGAGGGCTGA
 Primer design