SecReT4
Protein ID: 194366222
T4SS name [ID]VirB [403]
Gene symbol-
Locus tagSmal_2446
StrainStenotrophomonas maltophilia R551-3
Repliconchromosome [GenBank: NC_011071] [Browse all T4SS(s) in this replicon]
Location [Strand]2750462..2751715 [-]
Productconjugation TrbI family protein
Component typeVirB10
UniProt IDB4SNC4
KEGG IDsmt:Smal_2446
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.4e-49, Aligned region: 226..409
Protein Sequence: 417 a.a.     [Download]
>gi|194366222|ref|YP_002028832.1| conjugation TrbI family protein [Stenotrophomonas maltophilia R551-3]
MSQQNTPGNDPNNGRDESQSPYGAQGAPDAPSNPYFGTTQAEPAPDLDAAAPQLRSAEEQRLNRKALLFL
GGIVLLLMAMGFLLFRKGQDSDDAVQKVPDVARASTPTLPDVAPPPQAPPTAAEPIPMLPPMSQDEGPKL
VPIASRPEAMEPRGPTLVERRMAGVDDAALAAGNRAQPQRSAIDEQTRQALLANMMPNQQGQQKIRRGPD
VEDVSSATYIQSPDALLVRGTYLRCVLETRIITDLAGYTSCLLTEPVYSINGRNLLLPKGSKIYGAYGGG
PIGKRVEVIWDRITTPNGIDVAMSSPGVDQLGGAGHPGQYSAHWGSRIASALMISLISDAFKYAAAEHGP
ETTTIANNGMTVQSPYESATARTMERLANEALSSNRRPPTVTINQGTIVNVYVAKDVDFTNVLHPRR
 
Nucleotide Sequence: 1254 bp     [Download]
>gi|194363778|ref|NC_011071.1|:c2751715-2750462 Stenotrophomonas maltophilia R551-3 chromosome, complete genome
ATGAGCCAGCAGAACACTCCCGGAAACGACCCGAACAACGGACGCGACGAGAGCCAGAGCCCGTACGGCG
CACAGGGTGCCCCGGACGCGCCGTCGAATCCGTACTTCGGCACGACCCAGGCTGAGCCTGCGCCGGATCT
GGATGCGGCCGCGCCGCAGCTGCGCTCGGCCGAAGAACAGCGGTTGAACCGCAAGGCGCTGCTGTTCCTC
GGTGGCATCGTGCTGCTGCTGATGGCAATGGGCTTCCTGCTGTTCCGCAAGGGCCAGGATAGTGATGACG
CCGTGCAGAAGGTGCCGGATGTCGCACGTGCCAGCACGCCGACACTGCCGGACGTTGCGCCGCCTCCGCA
GGCGCCGCCGACTGCCGCCGAACCGATTCCGATGCTTCCGCCGATGTCGCAGGACGAAGGTCCGAAGCTG
GTGCCCATCGCATCCCGGCCGGAAGCCATGGAACCCCGTGGGCCGACGCTGGTCGAGCGCCGGATGGCTG
GCGTGGATGATGCCGCGCTTGCCGCAGGCAATCGCGCGCAACCGCAGCGCAGTGCGATCGACGAGCAGAC
CCGCCAGGCGCTGCTTGCGAACATGATGCCCAACCAGCAGGGGCAGCAGAAGATCCGCCGTGGGCCGGAC
GTGGAAGACGTCTCCAGTGCCACCTACATCCAAAGCCCCGATGCCCTGCTGGTGCGCGGCACCTACCTGC
GATGCGTGCTGGAAACCCGCATCATCACCGATCTCGCCGGCTATACCTCGTGCCTGCTGACCGAGCCGGT
GTACTCGATCAATGGTCGCAACCTGCTGCTGCCCAAGGGCTCCAAGATCTATGGCGCCTACGGCGGCGGT
CCGATCGGCAAGCGTGTGGAAGTGATCTGGGATCGCATCACCACCCCCAATGGTATCGACGTTGCGATGT
CCAGCCCGGGCGTGGATCAGCTGGGCGGCGCCGGTCATCCGGGCCAGTACAGCGCGCACTGGGGCAGCCG
TATCGCCTCAGCGCTGATGATCAGCCTGATTTCCGATGCCTTCAAGTACGCAGCCGCCGAGCATGGTCCG
GAGACGACCACCATCGCCAACAACGGCATGACTGTGCAGTCGCCCTATGAGAGCGCTACCGCTCGCACGA
TGGAGCGCCTGGCTAACGAGGCACTCAGCAGCAATCGTCGTCCGCCGACTGTCACCATCAATCAGGGCAC
GATCGTGAACGTCTACGTTGCCAAGGACGTCGACTTCACCAACGTGCTCCACCCCCGCCGGTAA
 Primer design