SecReT4
Protein ID: 194366223
T4SS name [ID]VirB [403]
Gene symbol-
Locus tagSmal_2447
StrainStenotrophomonas maltophilia R551-3
Repliconchromosome [GenBank: NC_011071] [Browse all T4SS(s) in this replicon]
Location [Strand]2751712..2752491 [-]
Productconjugal transfer protein TrbG
Component typeVirB9
UniProt IDB4SNC5
KEGG IDsmt:Smal_2447
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.6e-50, Aligned region: 28..255
Protein Sequence: 259 a.a.     [Download]
>gi|194366223|ref|YP_002028833.1| conjugal transfer protein TrbG [Stenotrophomonas maltophilia R551-3]
MSSRNIRGSALVLLSMLSLLFSAAAMAQAVDHYEYEKDRIYPVRTGLGLTTQIELSPNEKILDYSTGFSS
GWELTRRENVFYIKPKNVDVDTNMMVRTETHSYIFELKVVATDWRQLEQARRAGVQYKIAFVYPNDTVFG
VAQEAVEEEAKPLLSSELAKDRQYNFNYSYSTSKAKKMGWLIPVNAYDDGRFTYLKLPNSPEYKTGIFPA
VFGRETEYGEDFVVNTTVEGNTLIVHGTHPYLVIRHGDFVVGLRRNVKK
 
Nucleotide Sequence: 780 bp     [Download]
>gi|194363778|ref|NC_011071.1|:c2752491-2751712 Stenotrophomonas maltophilia R551-3 chromosome, complete genome
ATGAGTAGTCGAAATATCAGGGGAAGCGCACTGGTGCTGCTGTCGATGTTGTCGCTGTTGTTTTCAGCAG
CGGCGATGGCGCAGGCGGTGGACCACTACGAGTACGAGAAGGACCGCATCTATCCGGTTCGCACCGGCCT
GGGCCTGACCACCCAGATCGAACTGAGCCCGAACGAGAAGATCCTCGACTACAGCACCGGCTTCAGCAGC
GGCTGGGAACTGACCCGTCGCGAAAACGTGTTCTACATCAAGCCGAAGAACGTCGACGTCGACACCAACA
TGATGGTGCGCACCGAGACTCATTCCTACATCTTCGAGCTGAAGGTGGTGGCCACTGATTGGCGCCAGCT
GGAACAGGCCCGTCGTGCAGGCGTGCAGTACAAGATTGCCTTCGTCTATCCCAACGACACCGTGTTCGGC
GTCGCCCAGGAGGCGGTCGAGGAAGAGGCCAAGCCGCTGTTGAGCTCTGAACTGGCCAAGGACCGCCAGT
ACAACTTCAACTACTCCTATTCGACCAGCAAGGCGAAAAAGATGGGGTGGTTGATCCCGGTCAACGCCTA
CGACGATGGCCGCTTCACCTATCTGAAGCTGCCGAACTCGCCGGAATACAAGACCGGCATATTCCCGGCC
GTGTTCGGCCGTGAAACGGAATACGGTGAAGACTTCGTGGTCAACACCACGGTTGAAGGCAATACGCTGA
TCGTGCACGGGACGCACCCGTACCTGGTCATCCGCCATGGCGACTTCGTCGTCGGCCTGCGAAGGAACGT
GAAGAAATGA
 Primer design