SecReT4
Protein ID: 194366224
T4SS name [ID]VirB [403]
Gene symbol-
Locus tagSmal_2448
StrainStenotrophomonas maltophilia R551-3
Repliconchromosome [GenBank: NC_011071] [Browse all T4SS(s) in this replicon]
Location [Strand]2752488..2753543 [-]
ProductVirB8 family protein
Component typeVirB8
UniProt IDB4SNC6
KEGG IDsmt:Smal_2448
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.5e-57, Aligned region: 20..240
Protein Sequence: 351 a.a.     [Download]
>gi|194366224|ref|YP_002028834.1| VirB8 family protein [Stenotrophomonas maltophilia R551-3]
MFRKKDPGNSPKVEQSVAKAVSYEITVADMARRSERRAWWVATGSLLMSLALAGGYYYMLPLKEKVPFLV
MADAYTGTATVARLSGTFQGETITSNEAINRSNVAQYVLARESYDSAVMGLRDWELVFVMSTDPVAQSMR
VRYAGNNPQNPFVMYGRERAIRVKILSITPLGAEPNGSFRGASVRIQRSLLDKRTGVATYLDNQLVTMRF
GYNQNLALSEQDRILNPLAFQVTEYRVDNDYSRGVPVPDDGAMQAQAQQAAQAAQQAQAAYDPNNPAAAT
MIDPATGQPVAVPANGQVPGQPVQGQPVQGQPMPAQPVPGQATPGQAMPGQPAMRPAQNNSTGTADGASN
R
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|194363778|ref|NC_011071.1|:c2753543-2752488 Stenotrophomonas maltophilia R551-3 chromosome, complete genome
ATGTTCCGCAAGAAGGATCCCGGCAACAGTCCCAAGGTCGAGCAGTCGGTCGCCAAGGCGGTCAGCTACG
AGATCACCGTGGCCGACATGGCGCGTCGCAGCGAGCGTCGTGCCTGGTGGGTCGCCACGGGCTCGCTGTT
GATGTCGCTGGCATTGGCCGGTGGCTACTACTACATGCTGCCTCTGAAGGAGAAGGTGCCGTTCCTGGTG
ATGGCCGACGCGTACACGGGTACCGCGACGGTCGCGCGCCTGAGTGGCACCTTCCAGGGCGAGACCATCA
CCAGCAACGAAGCGATCAATCGCAGCAATGTGGCCCAGTACGTGCTGGCGCGCGAGTCGTACGACTCGGC
GGTGATGGGCCTGCGCGATTGGGAGCTGGTGTTCGTGATGTCCACCGATCCGGTGGCGCAGTCGATGCGC
GTGCGTTATGCCGGAAACAATCCACAGAACCCGTTCGTCATGTACGGCCGCGAGCGCGCCATCCGGGTCA
AGATCCTCAGCATCACGCCGCTGGGTGCTGAGCCGAATGGCAGCTTCCGCGGTGCTTCGGTGCGTATCCA
GCGCAGCCTGCTGGACAAGCGTACCGGCGTTGCCACTTATCTGGACAACCAGCTGGTGACGATGCGCTTC
GGCTACAACCAGAACCTGGCGCTGTCCGAACAGGATCGCATCCTCAATCCGCTGGCCTTCCAGGTCACCG
AGTACCGAGTCGACAACGATTATTCGCGTGGCGTACCGGTGCCGGATGACGGCGCCATGCAGGCACAGGC
GCAGCAGGCAGCACAGGCCGCGCAGCAGGCCCAGGCGGCCTACGATCCCAATAATCCGGCCGCAGCCACG
ATGATCGATCCGGCCACCGGCCAGCCGGTCGCCGTTCCGGCCAATGGCCAGGTGCCGGGTCAGCCCGTGC
AGGGCCAGCCGGTACAGGGGCAACCGATGCCGGCGCAGCCGGTGCCGGGTCAAGCAACACCGGGGCAGGC
CATGCCCGGTCAGCCGGCCATGAGGCCGGCGCAGAACAATTCCACCGGAACTGCTGATGGAGCAAGCAAC
CGATGA
 Primer design