SecReT4
Protein ID: 194366227
T4SS name [ID]VirB [403]
Gene symbol-
Locus tagSmal_2451
StrainStenotrophomonas maltophilia R551-3
Repliconchromosome [GenBank: NC_011071] [Browse all T4SS(s) in this replicon]
Location [Strand]2754506..2756185 [-]
ProductTRAG family protein
Component typeVirD4
UniProt IDB4SNC9
KEGG IDsmt:Smal_2451
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 9.3e-109, Aligned region: 112..550
TraG-D_C [PF12696], Evalue: 2.3e-27, Aligned region: 402..515
TrwB_AAD_bind [PF10412], Evalue: 1.3e-23, Aligned region: 188..520
Protein Sequence: 559 a.a.     [Download]
>gi|194366227|ref|YP_002028837.1| TRAG family protein [Stenotrophomonas maltophilia R551-3]
MLPSKKYLLIAIITLATLLLGFVFSGYLTLLLLGLDTKLFTWNTYYQYFNALGQPQVAPFVGKIKWAGYL
GFGLPLLVLLVTGLVLLLKKDKRSLHGDARFATSADLSKHGMFKKTGQSIVVGSHGGKLVRLDGQQFVIL
AAPTRSGKGVGVVIPNLLEYGESLVVLDIKQENFDLTSGWRASQGQEIYLFNPFAEDRRTHRWNPLSYVS
DDPAFRVSDLMSIAAMLYPDGAEDQKFWVSQARNAFMAFTLYLFENWDDERSSGFPGGSGTPTLGAVYRL
SSGDGSDLKKYLKALSERSFLSSNARSAFANMLSQADETFASILGTFKEPLNAWINPVLDKATSSNDFLL
TDVRKKKMTIYIGIQPNKLAESRLIINLFFSQLINLNTKELPKSNPDLKYQCLLLMDEFTSIGKVEIIAS
AVSYMAGYNIRLLPIIQSMSQLDATYGREVSRTIITNHALQILYAPREQQDANDYSDMLGYTTIRKKNVT
HAREKTHSFTEERRALMLPQELKAMGPDKEVFLYEGIPHPVKCDKIRYYKDRYFTSRLLPKVDVPMLNV
 
Nucleotide Sequence: 1680 bp     [Download]
>gi|194363778|ref|NC_011071.1|:c2756185-2754506 Stenotrophomonas maltophilia R551-3 chromosome, complete genome
GTGTTGCCCAGTAAGAAGTATCTGCTCATCGCCATCATCACGCTGGCGACCCTGCTGCTTGGTTTCGTGT
TTTCCGGTTACCTGACCCTGTTGTTGCTGGGGCTGGACACCAAGCTGTTCACCTGGAACACCTACTATCA
GTACTTCAACGCGCTCGGCCAGCCACAGGTCGCGCCCTTCGTGGGCAAGATCAAGTGGGCCGGCTATCTC
GGTTTCGGCCTGCCGCTGCTGGTGCTGCTGGTGACCGGCCTGGTGCTGCTGCTGAAGAAGGACAAGCGCT
CGCTGCACGGCGACGCACGCTTTGCCACCAGCGCCGACCTGTCCAAGCACGGCATGTTCAAGAAGACCGG
CCAGAGCATCGTGGTCGGCAGTCATGGTGGCAAGCTGGTGCGGCTGGACGGCCAGCAGTTCGTGATCCTG
GCCGCGCCGACCCGCTCGGGCAAGGGCGTGGGCGTCGTCATCCCGAACCTGCTGGAGTACGGCGAATCGC
TGGTGGTGCTGGACATCAAGCAGGAGAACTTCGACCTGACCAGCGGCTGGCGTGCCAGCCAGGGCCAGGA
GATCTACCTGTTCAATCCCTTCGCCGAAGACCGCCGCACGCATCGCTGGAATCCGCTCAGCTACGTCTCC
GACGACCCGGCGTTCCGCGTTTCGGACCTGATGAGCATCGCCGCGATGCTGTATCCGGATGGTGCCGAGG
ACCAGAAATTCTGGGTCAGCCAGGCGCGCAATGCGTTCATGGCCTTCACCCTGTATCTGTTCGAGAACTG
GGATGACGAGCGCAGCAGTGGCTTCCCGGGCGGCTCGGGCACGCCCACCCTGGGCGCTGTCTACCGGTTG
TCATCGGGTGACGGCAGCGATCTGAAGAAGTACCTCAAAGCCTTGTCGGAGCGGTCGTTCCTCAGTTCCA
ACGCGCGCTCGGCGTTTGCCAACATGCTGTCCCAGGCCGATGAGACCTTCGCCTCGATCCTGGGTACCTT
CAAGGAACCGCTCAACGCCTGGATCAACCCGGTGCTGGACAAGGCCACCAGCAGCAACGACTTCCTGCTG
ACCGATGTCCGCAAGAAGAAGATGACCATCTACATCGGCATCCAGCCCAACAAGCTGGCCGAGAGCCGCC
TGATCATCAACCTGTTCTTCAGCCAGCTGATCAACCTCAACACCAAGGAACTGCCCAAGTCCAACCCGGA
CCTGAAGTACCAGTGCCTGCTGCTGATGGACGAATTCACCTCGATCGGCAAGGTCGAGATCATCGCCTCG
GCGGTGTCCTACATGGCCGGCTACAACATCCGCCTGCTGCCGATCATCCAGAGCATGTCCCAGCTCGATG
CCACCTACGGGCGGGAGGTGTCGCGCACGATCATCACCAACCACGCGCTGCAGATCCTGTACGCGCCGCG
TGAGCAGCAGGACGCCAACGACTACTCGGACATGCTGGGTTACACCACCATCCGCAAGAAGAACGTCACC
CATGCCCGCGAGAAGACCCACAGCTTCACCGAGGAGCGGCGCGCACTGATGCTGCCGCAGGAGCTGAAGG
CGATGGGGCCGGACAAGGAAGTGTTCCTCTACGAGGGCATACCGCATCCTGTGAAGTGCGACAAGATCCG
CTACTACAAGGATCGCTACTTCACCTCGCGATTGCTGCCGAAAGTGGATGTTCCGATGCTTAACGTCTAA
 Primer design