SecReT4
Protein ID: 194446839
T4SS name [ID]Tra_F [91]
Gene symboltraX
Locus tagSeKA_D0032
StrainSalmonella enterica subsp. enterica serovar Kentucky str. CVM29188 plasmid pCVM29188_146 (NC_011076)
Repliconplasmid pCVM29188_146 [GenBank: NC_011076] [Browse all T4SS(s) in this replicon]
Location [Strand]20476..21222 [-]
Productconjugal transfer pilus acetylation protein TraX
Component typeTraX_F
UniProt IDB4TLB6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 2.9e-52, Aligned region: 32..247
Protein Sequence: 248 a.a.     [Download]
>gi|194446839|ref|YP_002038893.1| conjugal transfer pilus acetylation protein TraX [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188]
MTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLMVLDHINLIFQLKQEWMFLAGRGAFPL
FALVWGLNLSRHANIRQPAINRLWGWGIIAQFAYYLAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAA
AILLMALWGPLSGTSYGIAGLLMLAVSHRLYRAEDRAERLALVACLLAVIPALNLATSDAAAVAGLVMTV
LTVGLVSCAGKSLPRFWPGDFFPVFYACHLAVLGVLAL
 
Nucleotide Sequence: 747 bp     [Download]
>gi|194446816|ref|NC_011076.1|:c21222-20476 Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 plasmid pCVM29188_146, complete sequence
ATGACAACGGATAACACGAACACGACACGTAACGATTCACTGGCTGCACGGACCGATACCTGGTTGCAGT
CATTTCTGGTCTGGTCACCCGGACAGCGGGATATCATCAAAACGGTGGCACTGGTGCTGATGGTACTGGA
CCACATCAATCTGATATTCCAGCTGAAGCAGGAATGGATGTTTCTGGCCGGGCGAGGAGCCTTTCCGCTG
TTTGCCCTGGTGTGGGGGCTGAATCTGTCCCGTCATGCGAATATCCGGCAACCGGCCATTAACCGGCTGT
GGGGATGGGGGATTATTGCCCAGTTCGCATATTATCTGGCCGGCTTTCCCTGGTATGAGGGGAATATCCT
GTTTGCCTTTGCAGTGGCGGCACAGGTGCTGACGTGGTGTGAAACGCGCAGTGGGTGGCGTACAGCAGCG
GCCATTCTTCTGATGGCCCTGTGGGGGCCTTTGTCCGGCACCAGTTACGGCATTGCCGGGCTGCTGATGC
TGGCAGTCAGCCACCGGCTGTACCGGGCGGAAGACAGAGCGGAACGTCTGGCGCTGGTCGCCTGCCTGCT
GGCTGTTATTCCGGCGCTTAACCTTGCCACCAGTGATGCAGCGGCGGTGGCTGGTCTTGTGATGACGGTG
CTGACCGTTGGTCTGGTGTCGTGTGCAGGAAAATCATTACCCCGTTTCTGGCCCGGGGATTTTTTCCCGG
TATTCTACGCCTGTCATCTGGCTGTGCTGGGCGTTCTGGCGCTGTGA
 Primer design