SecReT4
Protein ID: 194446937
T4SS name [ID]Tra_F [91]
Gene symboltraF
Locus tagSeKA_D0043
StrainSalmonella enterica subsp. enterica serovar Kentucky str. CVM29188 plasmid pCVM29188_146 (NC_011076)
Repliconplasmid pCVM29188_146 [GenBank: NC_011076] [Browse all T4SS(s) in this replicon]
Location [Strand]36034..36777 [-]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDB4TLC7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 5.5e-77, Aligned region: 23..237
Protein Sequence: 247 a.a.     [Download]
>gi|194446937|ref|YP_002038904.1| conjugal pilus assembly protein TraF [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188]
MNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAASRQEPDIMQKLAALQTATKRALYEAI
LYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAADQVQQRQAIAKL
AEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVKYFPAMM
LVDPKQGSVRPLSYGFISQDYLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 744 bp     [Download]
>gi|194446816|ref|NC_011076.1|:c36777-36034 Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 plasmid pCVM29188_146, complete sequence
ATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTATTTTTCCGGCGTCAGGAAAAGATGCAGGCT
GGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAAAGAAAATAAACCAGTACCTGCAGCCTCCCGTCA
GGAGCCGGACATTATGCAGAAACTGGCCGCACTGCAGACGGCAACAAAGCGGGCGCTGTATGAAGCTATT
CTGTATCCCGGCGTGGATAATTTTGTGAAATATTTCCGGCTGCAGAATTACTGGACTCAGCAGGCCGGGC
TTTTCACCATGAGCGCCAAAAAAGCCATGCTGGCGCATCCCGAACTGGACTATAACCTGCAGTACAGCCA
TTACAACGGCACGGTCCGGAACCAGCTGGCGGCAGACCAGGTGCAGCAGCGACAGGCCATTGCGAAACTG
GCTGAACACTACGGCATCATGTTCTTTTACCGGGGGCAGGACCCCATCGACGGGCAGCTGGCGCAGGTCA
TTAATGGCTTCAGGGATACCTATGGTCTGAGTGTTATTCCCGTTTCCGTGGATGGCGTGATTAATCCGCT
GTTGCCGGATTCCAGGACTGACCAGGGGCAGGCGCAGCGCCTCGGCGTGAAATATTTCCCGGCCATGATG
CTGGTTGACCCGAAACAGGGCAGTGTTCGCCCGTTATCATACGGTTTTATTTCGCAGGACTACCTGGCAA
AACAATTCCTGAACGTTTCTGAAGATTTTAAACCCAATTTTTAA
 Primer design