SecReT4
Protein ID: 194446938
T4SS name [ID]Tra_F [91]
Gene symboltraL
Locus tagSeKA_D0061
StrainSalmonella enterica subsp. enterica serovar Kentucky str. CVM29188 plasmid pCVM29188_146 (NC_011076)
Repliconplasmid pCVM29188_146 [GenBank: NC_011076] [Browse all T4SS(s) in this replicon]
Location [Strand]48919..49230 [-]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDB4TLE4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 4.3e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|194446938|ref|YP_002038921.1| conjugal transfer pilus assembly protein TraL [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGITTSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|194446816|ref|NC_011076.1|:c49230-48919 Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 plasmid pCVM29188_146, complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTATTGGCTGGGGTATCACAACATCGAAATA
TCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design