SecReT4
Protein ID: 194446973
T4SS name [ID]Tra_F [91]
Gene symboltraQ
Locus tagSeKA_D0041
StrainSalmonella enterica subsp. enterica serovar Kentucky str. CVM29188 plasmid pCVM29188_146 (NC_011076)
Repliconplasmid pCVM29188_146 [GenBank: NC_011076] [Browse all T4SS(s) in this replicon]
Location [Strand]35268..35552 [-]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDB4TLC5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 2.3e-51, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|194446973|ref|YP_002038902.1| conjugal transfer pilin chaperone TraQ [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188]
MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSRE
EREALEARQQAMMEGQQEGRHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|194446816|ref|NC_011076.1|:c35552-35268 Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 plasmid pCVM29188_146, complete sequence
ATGATAAGTAAACGCAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTAGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGTTGAT
TGCGGCCATCCTTGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCCCGTGTCAGCCGGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCAGACATGTCTCTC
ATTAA
 Primer design