SecReT4
Protein ID: 194446993
T4SS name [ID]Tra_I [171]
Gene symbol-
Locus tagSeKA_C0105
StrainSalmonella enterica subsp. enterica serovar Kentucky str. CVM29188 plasmid pCVM29188_101 (NC_011077)
Repliconplasmid pCVM29188_101 [GenBank: NC_011077] [Browse all T4SS(s) in this replicon]
Location [Strand]69520..70212 [-]
ProductTraM
Component typeTraM_I
UniProt IDB4TL57
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 3.4e-34, Aligned region: 77..184
Protein Sequence: 230 a.a.     [Download]
>gi|194446993|ref|YP_002039140.1| TraM [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188]
MTENTEPSSPSHPAPDPEILKSTIRAMKQSEQRANNVPALIKALLCTGTCLLISITGNAIQYWHSTNVER
EYFATDNGRLVRLAPTSQPAWSQNDAMAFGSQALATAFNLDFVHYRSQISSLSPRFSDEGFVGYVNALQA
SNILETIKKEKMNLTATTGAGVLVRQGQMSDGVWFWTFQYPVRMRLVGQTTSKPEQSFVFEITIQRVDPR
LKPSGMEIRQMISRNAGPNS
 
Nucleotide Sequence: 693 bp     [Download]
>gi|194446987|ref|NC_011077.1|:c70212-69520 Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 plasmid pCVM29188_101, complete sequence
ATGACCGAAAATACCGAGCCATCCTCGCCATCACATCCGGCACCTGACCCGGAAATACTGAAGAGCACAA
TCAGGGCTATGAAGCAGTCAGAACAGCGGGCAAATAATGTCCCTGCGCTGATAAAAGCGCTTTTATGTAC
GGGCACATGTCTTCTTATCAGTATTACTGGTAACGCCATTCAGTACTGGCACTCAACGAATGTGGAGCGC
GAATATTTCGCTACAGACAATGGTCGTCTGGTCAGGCTGGCACCAACAAGTCAGCCAGCATGGAGTCAGA
ATGATGCAATGGCCTTTGGCAGCCAGGCACTGGCGACCGCATTCAACCTGGATTTTGTGCACTATCGTTC
ACAGATCTCCTCCCTGTCTCCGCGTTTTTCTGACGAAGGTTTTGTCGGATATGTGAATGCATTACAGGCA
TCTAACATTCTGGAGACGATCAAGAAAGAGAAGATGAATCTGACCGCCACGACAGGTGCTGGCGTTCTGG
TACGACAGGGACAAATGTCCGACGGCGTATGGTTCTGGACATTCCAGTATCCTGTCCGTATGCGTCTGGT
CGGCCAGACAACCAGCAAGCCAGAACAGTCTTTTGTTTTCGAAATCACCATCCAGCGTGTTGACCCCAGA
CTGAAACCATCCGGTATGGAAATCCGGCAGATGATCTCCCGTAACGCCGGACCGAACTCCTGA
 Primer design