SecReT4
Protein ID: 194447088
T4SS name [ID]Tra_I [171]
Gene symbol-
Locus tagSeKA_C0106
StrainSalmonella enterica subsp. enterica serovar Kentucky str. CVM29188 plasmid pCVM29188_101 (NC_011077)
Repliconplasmid pCVM29188_101 [GenBank: NC_011077] [Browse all T4SS(s) in this replicon]
Location [Strand]70209..70556 [-]
ProductTraL
Component typeTraL_I
UniProt IDB4TL58
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 115 a.a.     [Download]
>gi|194447088|ref|YP_002039141.1| TraL [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188]
MNMHKSLVAVLGLILISSTASAATCRAGSAAQAGSNTGYERARAAADAWSQRENDVSSSLQSCLSRIKKI
SINLPQFPSLDDILSQLENQVCDAVVDKVNEKLPGNIDPWKDYNL
 
Nucleotide Sequence: 348 bp     [Download]
>gi|194446987|ref|NC_011077.1|:c70556-70209 Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 plasmid pCVM29188_101, complete sequence
ATGAACATGCATAAGTCTCTGGTTGCCGTGCTCGGCCTTATCCTGATTTCATCCACGGCAAGTGCTGCAA
CCTGTCGTGCGGGTAGCGCGGCACAGGCCGGTAGTAATACAGGATATGAGCGAGCACGTGCAGCTGCGGA
TGCATGGTCACAACGTGAAAACGATGTTTCCTCATCCCTGCAGTCCTGTCTGTCACGAATCAAAAAAATC
AGCATAAACCTCCCCCAGTTCCCCAGCCTTGACGACATTCTGTCGCAGCTGGAAAACCAGGTCTGCGACG
CGGTCGTGGACAAGGTGAATGAAAAGCTGCCGGGGAATATTGATCCCTGGAAGGACTACAACCTATGA
 Primer design