SecReT4
Protein ID: 194447108
T4SS name [ID]Tra_I [171]
Gene symbol-
Locus tagSeKA_C0097
StrainSalmonella enterica subsp. enterica serovar Kentucky str. CVM29188 plasmid pCVM29188_101 (NC_011077)
Repliconplasmid pCVM29188_101 [GenBank: NC_011077] [Browse all T4SS(s) in this replicon]
Location [Strand]61378..64422 [-]
ProductTraU
Component typeTraU_I
UniProt IDB4TL49
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.3e-45, Aligned region: 502..898
Protein Sequence: 1014 a.a.     [Download]
>gi|194447108|ref|YP_002039132.1| TraU [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188]
MNINRFIFTIEDCLNTLSRFSVASSFVEYCDLRTVIGLDRQDRERRPWLNSPYIAATKRGEYLSVFEVSG
AFKEMDEASDQTGPGSLESLITSMSDSLNTAYKNSGHKISCVFERDPEMGKEEIEDMVAPQKRSLANTGI
QLQDVVDEKVTTLSPWLVRERCWLAIWSGPDLISNSDRTAHDELVRRLAERVPKARFAQSPWQWTLSALK
IRHEAFLDNVEQALRHSSDGLILRLLDIHEVGREIRRQTERYSTPRNWQPHLPEDAQPAGYRWTDDESVL
HAPSLHLQLFNTQVTTQGNLVQAGGLWHGMVSITLPPQNLQTFNELVRAVPRAVPWRIRMDLMPGGMKAL
NLKKTLLTYSSFISAVRPMYESVMTLAATDEKEPVCIMTIMASTWGKTREICARNQAILKSAIEGWGVCG
TTTTFGDPRRAWVNTILAASGGSGPVPLYPPLSHAISLFPLNRAGSVWRGKGNLMLHTEDGSAFEVGLAS
SQQNKHTELAPGDPGLGKSVLINTLSEIQISSAQKNLPFIAYIDKGYSAQGLVQLIRDSLPPERKDEAVG
IILSNDPEYTRNLFDVMYGAKKPITPEKNFMSSVLCALCVDTGTGQPCNPGDTRQIINQLIELAFKEYGE
NNPRLYRASTEELVDSALQDSGLYEKHDAAWWARSTWFEVRDMLHNAGYIMAAQRAHYQAMPQLPEVSSM
LGHTSLRDVFGTVQRDGSNELLLDYIRRALEQGHNDYPMISGYTRFMINPETRVIAVDLNNVAGDKTPAG
RLKTGIMYLLAGQIAGGDFTLPQYRDEVLKQLPREYHEIALKRINQLDQEVKTKVYDELHNARGIDFIWE
NLDTQEREQRKFAIRTVLSTQYLRDYPESVLKSANTLWLIRYKPEDIPVLRDNFNVPEFMLKRFLKMPEG
PAPDGSGVPVLGVFRVKSGTLARILKFTVGPLELWALNSSPKDSALRKTLTNKLGSVRARKILAENFPRG
SATSLIEHRAGQHNSDNVIEDLASELIRKQGYNL
 
Nucleotide Sequence: 3045 bp     [Download]
>gi|194446987|ref|NC_011077.1|:c64422-61378 Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188 plasmid pCVM29188_101, complete sequence
ATGAACATAAACCGTTTCATCTTCACTATCGAAGACTGTCTGAACACGCTATCCCGTTTCTCTGTCGCAA
GCAGTTTTGTTGAGTATTGCGATTTACGTACTGTAATTGGTCTGGACAGACAGGATCGTGAACGTCGCCC
ATGGCTTAATTCGCCCTATATTGCAGCCACAAAGCGTGGAGAATATCTCTCTGTCTTTGAAGTCAGCGGT
GCTTTCAAGGAAATGGATGAAGCATCCGACCAGACTGGCCCAGGTTCACTGGAATCGCTGATCACCAGCA
TGAGTGACAGCCTGAATACGGCATATAAAAACAGCGGTCATAAAATCAGCTGCGTTTTCGAGCGTGACCC
TGAAATGGGGAAAGAAGAAATCGAAGACATGGTCGCCCCACAAAAACGCTCACTGGCTAATACAGGTATC
CAGTTACAGGATGTGGTCGATGAGAAAGTCACAACACTGTCCCCATGGCTGGTCCGGGAGCGCTGCTGGC
TGGCGATCTGGAGTGGACCCGACCTTATCAGCAACAGCGATCGCACCGCCCATGATGAGCTTGTCAGAAG
ACTGGCTGAACGGGTACCGAAAGCACGCTTTGCCCAGTCCCCCTGGCAGTGGACCTTATCTGCACTGAAA
ATCCGCCACGAAGCTTTTCTTGATAATGTGGAACAGGCACTGAGACATTCATCTGATGGCCTGATTCTCC
GGCTACTGGATATACACGAGGTCGGGCGTGAAATACGTCGTCAGACAGAACGGTACAGCACACCGCGTAA
CTGGCAACCCCACCTGCCTGAAGATGCCCAGCCAGCGGGATATCGCTGGACTGACGATGAATCCGTACTA
CATGCTCCTTCATTGCATTTGCAGTTATTCAACACGCAGGTGACCACACAGGGCAACCTGGTTCAGGCGG
GCGGACTCTGGCACGGAATGGTATCGATTACTTTACCTCCGCAAAATCTGCAGACGTTTAACGAACTGGT
CCGTGCCGTCCCCCGCGCAGTCCCCTGGCGCATCAGAATGGATCTGATGCCCGGCGGGATGAAGGCTCTT
AATCTGAAGAAAACGCTTCTGACTTACAGCAGCTTCATTTCTGCCGTTCGTCCAATGTATGAATCCGTTA
TGACTCTGGCGGCAACGGATGAAAAAGAACCTGTCTGCATAATGACCATCATGGCCTCCACGTGGGGAAA
AACACGTGAAATATGCGCACGAAACCAGGCCATTCTGAAATCGGCCATTGAAGGCTGGGGCGTATGTGGC
ACCACGACAACATTTGGCGATCCCCGACGCGCCTGGGTGAATACCATTCTCGCGGCGTCCGGAGGCTCCG
GCCCGGTTCCCCTGTATCCCCCGTTGTCACATGCCATCTCGCTTTTCCCGCTTAACAGGGCAGGCTCTGT
CTGGCGAGGCAAAGGGAATCTGATGTTACATACAGAAGACGGTTCCGCATTTGAGGTTGGTCTGGCGTCA
TCCCAACAAAATAAACATACAGAACTGGCACCAGGCGATCCGGGACTGGGTAAATCAGTTCTGATTAATA
CGTTGTCGGAAATACAGATATCATCTGCTCAGAAAAACCTGCCCTTCATTGCCTATATCGATAAGGGATA
CAGTGCTCAGGGACTGGTTCAGCTTATTCGCGACAGTCTTCCTCCGGAAAGAAAAGACGAAGCTGTCGGT
ATTATTCTGAGCAATGATCCGGAATACACCCGTAACCTTTTTGACGTGATGTACGGCGCTAAAAAGCCTA
TTACGCCGGAAAAGAATTTCATGTCATCGGTGCTGTGTGCTCTCTGTGTCGATACCGGTACCGGTCAACC
CTGTAACCCCGGAGACACCCGACAAATTATCAACCAGCTTATCGAGCTGGCTTTTAAAGAGTACGGTGAA
AATAATCCGCGACTTTATCGCGCTTCAACGGAAGAACTGGTGGATTCAGCACTGCAGGACTCGGGACTGT
ATGAAAAACATGATGCAGCCTGGTGGGCCAGATCAACCTGGTTCGAAGTCCGGGATATGCTCCACAATGC
CGGGTATATCATGGCGGCTCAGCGGGCTCATTATCAGGCAATGCCCCAGCTTCCCGAAGTGTCCTCGATG
CTGGGCCATACCAGTCTCAGGGATGTTTTCGGTACTGTTCAGCGTGATGGTTCAAACGAGCTTCTGCTGG
ACTACATCCGCCGCGCCCTGGAGCAGGGACATAACGACTACCCCATGATATCCGGGTATACCCGGTTTAT
GATCAACCCGGAAACCCGGGTCATCGCTGTCGATCTGAATAATGTTGCCGGTGACAAAACGCCTGCAGGC
AGGCTTAAAACCGGCATCATGTACCTGCTTGCAGGTCAGATCGCCGGTGGTGACTTCACCCTGCCACAAT
ACAGGGATGAAGTGTTAAAGCAGCTTCCACGGGAATACCATGAAATCGCTCTTAAACGTATTAACCAACT
TGATCAGGAGGTTAAGACAAAAGTTTATGATGAACTGCATAACGCCCGGGGAATTGACTTCATCTGGGAA
AATCTGGATACCCAGGAGCGCGAACAACGCAAGTTTGCTATCCGCACGGTTCTGAGTACGCAGTATCTGA
GGGACTACCCGGAAAGCGTTCTTAAGTCAGCAAATACTCTCTGGTTAATACGCTACAAACCCGAAGATAT
CCCCGTACTGAGGGATAACTTCAACGTGCCTGAATTTATGCTGAAACGCTTCCTGAAAATGCCGGAAGGC
CCGGCACCAGATGGTAGTGGTGTTCCTGTTCTGGGAGTATTCAGGGTAAAAAGTGGCACGCTTGCGAGAA
TACTCAAATTTACCGTCGGTCCACTGGAGCTATGGGCGCTGAACTCATCGCCAAAAGACAGTGCCCTGCG
TAAAACGCTGACAAATAAGTTAGGTTCAGTTCGGGCACGTAAGATTCTGGCCGAAAACTTCCCCAGAGGT
TCTGCAACGTCATTAATTGAGCACCGGGCGGGCCAACATAACAGTGACAATGTTATTGAAGATCTGGCCT
CGGAGCTCATCCGAAAACAGGGATACAATCTCTGA
 Primer design