SecReT4
Protein ID: 194447246
T4SS name [ID]Tra_I [170]
Gene symbol-
Locus tagSeHA_A0097
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. SL476
Repliconplasmid pSL476_91 [GenBank: NC_011081] [Browse all T4SS(s) in this replicon]
Location [Strand]63201..63548 [-]
ProductTraL
Component typeTraL_I
UniProt IDB4T7G9
KEGG IDseh:SeHA_A0097
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 115 a.a.     [Download]
>gi|194447246|ref|YP_002043932.1| TraL [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476]
MNMHKSLVAVLGLILISSTASAATCRAGSAAQAGSNTGYERARAAADAWSQRENDVSSSLQSCLSRIKKI
SINLPQFPSLDDILSQLENQVCDAVVDKVNEKLPGNIDPWKDYNL
 
Nucleotide Sequence: 348 bp     [Download]
>gi|194447175|ref|NC_011081.1|:c63548-63201 Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 plasmid pSL476_91, complete sequence
ATGAACATGCATAAGTCTCTGGTTGCCGTGCTCGGCCTTATCCTGATTTCATCCACGGCAAGTGCTGCAA
CCTGTCGTGCGGGTAGCGCGGCACAGGCCGGTAGTAATACAGGATATGAGCGAGCACGTGCAGCTGCGGA
TGCATGGTCACAACGTGAAAACGATGTTTCCTCATCCCTGCAGTCCTGTCTGTCACGAATCAAAAAAATC
AGCATAAACCTCCCCCAGTTCCCCAGCCTTGACGACATTCTGTCGCAGCTGGAAAACCAGGTCTGCGACG
CGGTCGTGGACAAGGTGAATGAAAAGCTGCCGGGGAATATTGATCCCTGGAAGGACTACAACCTATGA
 Primer design