SecReT4
Protein ID: 194447253
T4SS name [ID]Tra_I [170]
Gene symbol-
Locus tagSeHA_A0088
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. SL476
Repliconplasmid pSL476_91 [GenBank: NC_011081] [Browse all T4SS(s) in this replicon]
Location [Strand]54370..57414 [-]
ProductTraU
Component typeTraU_I
UniProt IDB4T7G0
KEGG IDseh:SeHA_A0088
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.8e-46, Aligned region: 502..898
Protein Sequence: 1014 a.a.     [Download]
>gi|194447253|ref|YP_002043923.1| TraU [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476]
MNINRLIFTIEDCLNTLSRFSVASSFVEYCDLRTVIGLDRQDRERRPWLNSPYIAATKRGEYLSVFEVSG
AFREMDEASDQTGPGSLESLITSMSDSLNTAYKNSGHKISFVFERDPDMGKEEIEDMVAPQKRSLANTGI
QLQDVVDEKVTTLSPWLVRERCWLAIWSGPDLISNSDRTAHDELVRRLAERVPKARFAQSPWQWTLSALK
IRHEAFLDNVEQALRHSSDGLILRLLDIHEVGREIRRQTERHSTPRNWQPHLPEDAQPAGYRWTDDESVL
HAPSLHLQLFNTQVTTQGNLVQAGGLWHGMVSITLPPQNLQTFNELVRAVPRAVPWRIRMDLMPGGMKAL
NLKKTLLTYSSFISAVRPMYESVMALAATDEKEPVCIMTIMASTWGKTREICTRNQAILKSAIEGWGVCG
TTTTFGDPRRAWVNTILAASGGSGPVPLYPPLSHAISLFPLNRAGSVWRGKGNLMLHTEDGSAIEVGLAS
SQQNKHTELAPGDPGLGKSVLINTLSEIQISSAQKNLPFIAYIDKGYSAQGLVQLIRDSLPPERKDEAVG
IILSNDPEYTRNLFDVMYGAKKPITPEKNFMSSVLCALCVDTGTGQPCNPGDTRQIINQLIELAFKEYGE
NNPRLYRASTEELVDSALQDSGLYEKHDATWWARSTWFEVRDMLHNAGYIMAAQRAHYQAMPQLPEVSSM
LGHTSLRDVFGTVQRDGSNELLLDYIRRALEQGHNDYPMISGYTRFMINPETRVIAVDLNNVAGDKTPAG
RLKTGIMYLLAGQIAGGDFTLPQYRDEVLKQLPREYHEIALKRINQLDQEVKTKVYDELHNARGIDFIWE
NLDTQEREQRKFAIRTVLSTQYLRDYPESVLKSANTLWLLRYKPEDIPVLRDNFNVPEFMLKRFLKMPEG
PAPDGSGVPVLGVFRVKSGTLARILKFTVGPLELWALNSSPKDSALRKTLTNKLGSVRARKILAENFPRG
SATSLIEHRAGQHNSDNVIEELASELIRKQGYNL
 
Nucleotide Sequence: 3045 bp     [Download]
>gi|194447175|ref|NC_011081.1|:c57414-54370 Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 plasmid pSL476_91, complete sequence
ATGAACATAAACCGTTTAATCTTCACTATCGAAGACTGTCTGAACACGCTATCCCGTTTCTCTGTCGCAA
GCAGTTTTGTTGAGTATTGCGATTTACGTACTGTAATAGGTCTGGACAGACAGGATCGTGAACGTCGCCC
ATGGCTGAATTCGCCCTATATTGCAGCCACAAAGCGTGGAGAATATCTCTCTGTCTTTGAAGTCAGCGGT
GCTTTCAGGGAAATGGATGAAGCATCCGACCAGACTGGCCCAGGTTCACTGGAATCGCTGATCACCAGCA
TGAGTGACAGCCTGAATACGGCATATAAAAACAGCGGTCATAAAATCAGCTTCGTTTTTGAGCGTGATCC
TGACATGGGGAAAGAAGAAATCGAAGACATGGTCGCCCCACAAAAGCGCTCACTGGCTAATACAGGTATC
CAGTTACAGGATGTGGTCGATGAGAAAGTCACAACACTGTCCCCATGGCTGGTCCGGGAGCGTTGCTGGC
TGGCGATCTGGAGTGGACCCGACCTTATCAGCAACAGCGATCGCACCGCCCATGATGAGCTTGTCAGAAG
ACTGGCTGAACGGGTACCGAAAGCACGCTTTGCCCAGTCCCCCTGGCAGTGGACCTTATCTGCACTGAAA
ATCCGCCACGAAGCTTTTCTTGATAATGTGGAACAGGCACTGAGACATTCATCTGATGGCCTGATTCTCC
GGCTACTGGATATACACGAGGTCGGGCGTGAAATACGTCGTCAGACAGAACGGCACAGCACACCGCGTAA
CTGGCAACCCCACCTGCCTGAAGATGCCCAGCCAGCGGGATATCGCTGGACTGACGATGAATCCGTACTA
CATGCTCCTTCATTGCATTTGCAGTTATTCAACACTCAGGTGACCACACAGGGCAACCTGGTTCAGGCGG
GCGGACTCTGGCACGGAATGGTATCGATTACTTTACCTCCGCAAAATCTGCAGACGTTTAACGAACTGGT
CCGTGCCGTCCCCCGCGCAGTCCCCTGGCGCATCAGAATGGATCTGATGCCCGGCGGGATGAAGGCTCTT
AATCTGAAGAAAACGCTTCTGACTTACAGCAGTTTCATTTCTGCCGTTCGTCCAATGTATGAATCCGTTA
TGGCCCTGGCGGCAACGGATGAAAAAGAACCTGTCTGCATAATGACCATCATGGCCTCCACGTGGGGAAA
AACACGTGAAATATGCACACGAAACCAGGCCATTCTGAAATCAGCCATTGAAGGCTGGGGCGTATGTGGC
ACCACGACAACATTTGGCGATCCCCGACGCGCCTGGGTGAATACCATTCTCGCGGCATCCGGAGGCTCCG
GCCCGGTTCCCCTGTATCCCCCGTTGTCACATGCCATCTCGCTTTTCCCGCTTAACAGGGCAGGCTCTGT
CTGGCGAGGCAAAGGGAATCTGATGTTACATACAGAAGACGGTTCCGCAATTGAGGTTGGTCTGGCGTCA
TCCCAACAAAATAAACATACAGAACTCGCACCAGGCGATCCGGGACTGGGTAAATCAGTTCTGATTAATA
CATTGTCGGAAATACAGATATCATCTGCTCAGAAAAACCTGCCCTTCATTGCCTATATCGATAAGGGATA
CAGTGCTCAGGGACTGGTTCAGCTTATTCGCGACAGTCTTCCTCCGGAAAGAAAAGACGAAGCTGTCGGT
ATTATTCTGAGCAATGATCCGGAATACACCCGTAACCTTTTTGACGTGATGTACGGCGCTAAAAAGCCTA
TTACGCCGGAAAAGAATTTCATGTCATCGGTGCTGTGTGCTCTCTGTGTCGATACCGGTACCGGTCAACC
CTGTAACCCCGGAGACACCCGACAAATTATCAACCAGCTTATCGAGCTGGCTTTTAAAGAGTACGGTGAA
AATAATCCGCGACTTTATCGCGCCTCAACGGAAGAACTGGTGGATTCAGCACTGCAGGACTCGGGACTGT
ATGAAAAACATGATGCAACCTGGTGGGCCAGATCAACCTGGTTCGAAGTCCGGGATATGCTCCACAATGC
CGGGTATATCATGGCGGCTCAGCGGGCACATTATCAGGCAATGCCCCAGCTTCCCGAAGTGTCCTCGATG
CTGGGCCATACCAGTCTCAGGGATGTTTTCGGTACTGTTCAGCGTGATGGTTCAAACGAACTTCTGCTGG
ACTACATCCGCCGCGCTCTCGAGCAGGGACATAACGACTACCCCATGATATCCGGGTATACCCGGTTTAT
GATCAACCCGGAAACCCGGGTCATCGCTGTCGATCTGAATAATGTTGCCGGTGACAAAACGCCTGCAGGC
AGGCTTAAAACCGGCATCATGTACCTGCTTGCAGGTCAGATCGCCGGTGGTGACTTCACCCTGCCACAAT
ACAGGGATGAAGTGTTAAAGCAACTTCCACGGGAATACCATGAAATCGCTCTTAAACGTATTAACCAACT
TGATCAGGAGGTTAAGACAAAAGTTTATGATGAACTGCATAACGCCCGGGGCATTGACTTCATCTGGGAA
AATCTGGATACCCAGGAGCGTGAGCAACGCAAGTTTGCTATCCGCACGGTTCTGAGTACGCAGTATCTGA
GGGACTACCCGGAAAGCGTTCTTAAGTCAGCAAATACTCTCTGGTTACTGCGCTACAAACCCGAAGATAT
CCCCGTACTGAGGGATAACTTCAACGTTCCTGAATTTATGCTGAAACGCTTCCTGAAAATGCCGGAAGGC
CCGGCACCAGATGGTAGTGGTGTTCCTGTTCTGGGAGTATTCAGGGTAAAAAGTGGCACGCTTGCGAGAA
TACTCAAATTTACCGTCGGTCCACTGGAGCTATGGGCGCTGAACTCATCGCCAAAAGACAGTGCCCTGCG
TAAAACACTGACAAATAAGTTAGGTTCAGTTCGGGCACGTAAGATTCTGGCCGAAAACTTCCCCAGAGGT
TCTGCAACGTCATTAATTGAGCACCGGGCGGGCCAACATAACAGTGACAATGTTATTGAAGAACTGGCCT
CGGAGCTCATCCGAAAACAGGGATACAATCTCTGA
 Primer design