SecReT4
Protein ID: 194447285
T4SS name [ID]Tra_I [170]
Gene symbol-
Locus tagSeHA_A0096
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. SL476
Repliconplasmid pSL476_91 [GenBank: NC_011081] [Browse all T4SS(s) in this replicon]
Location [Strand]62512..63204 [-]
ProductTraM
Component typeTraM_I
UniProt IDB4T7G8
KEGG IDseh:SeHA_A0096
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 2e-34, Aligned region: 77..184
Protein Sequence: 230 a.a.     [Download]
>gi|194447285|ref|YP_002043931.1| TraM [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476]
MTENTEPSSPSHPAPDPEILKSTIRAMKQSEQRANNVPALIKALLCTGTCLLISITGNAIQYWHSTNVER
EYFATDNGRLVRLAPTNQPAWSQNDAMAFGSQALATAFNLDFVHYRSQISSLSPRFSDEGFAGYVNALQA
SNILETIKKEKMNLTATTGAGVLVRQGQMSDGVWFWTFQYPVRMRLVGQTTSKPEQSFVFEITIQRVDPR
LKPSGMEIRQMISRNAGPNS
 
Nucleotide Sequence: 693 bp     [Download]
>gi|194447175|ref|NC_011081.1|:c63204-62512 Salmonella enterica subsp. enterica serovar Heidelberg str. SL476 plasmid pSL476_91, complete sequence
ATGACCGAAAATACCGAGCCATCCTCGCCATCACATCCGGCACCTGACCCGGAAATACTGAAGAGCACAA
TCAGGGCTATGAAGCAGTCAGAACAGCGGGCAAATAATGTCCCTGCGCTGATAAAAGCGCTTTTATGTAC
GGGCACATGTCTTCTTATCAGTATTACTGGTAACGCCATTCAGTACTGGCACTCAACGAATGTGGAGCGC
GAATATTTCGCTACAGACAATGGTCGTCTGGTCAGGCTGGCACCAACAAATCAGCCAGCATGGAGTCAGA
ATGACGCAATGGCCTTTGGCAGCCAGGCACTGGCGACCGCATTCAACCTGGATTTTGTGCACTATCGTTC
ACAGATTTCCTCTCTGTCTCCGCGTTTTTCTGACGAAGGTTTTGCCGGATATGTGAATGCATTACAGGCA
TCTAACATTCTGGAGACGATCAAGAAAGAGAAGATGAATCTGACCGCCACGACAGGCGCTGGCGTTCTGG
TACGACAGGGACAAATGTCCGACGGCGTATGGTTCTGGACATTTCAGTATCCTGTCCGTATGCGTCTGGT
CGGCCAGACAACCAGCAAGCCAGAACAGTCTTTTGTTTTCGAAATCACCATCCAGCGTGTTGACCCCAGA
CTGAAACCATCCGGTATGGAAATCCGGCAGATGATCTCCCGTAACGCCGGACCGAACTCCTGA
 Primer design