SecReT4
Protein ID: 194733778
T4SS name [ID]VirB [466]
Gene symbol-
Locus tagSeSA_B0124
StrainSalmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
Repliconplasmid pCVM19633_110 [GenBank: NC_011092] [Browse all T4SS(s) in this replicon]
Location [Strand]103389..105296 [+]
Productmobilization protein
Component typeVirD4
UniProt IDB4TM80
KEGG IDsew:SeSA_B0124
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 6.3e-08, Aligned region: 418..533
TraG-D_C [PF12696], Evalue: 7.4e-08, Aligned region: 406..496
Protein Sequence: 635 a.a.     [Download]
>gi|194733778|ref|YP_002113000.1| mobilization protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633]
MIFDKLNHLLSPIANAVLAFIAFLQAHQLALALLSGVMLPFIFSAKHGGQEKPTFLQRILILLSMICFVF
GSIAPVAVWFLQRIYGREDIASPPLLTWTMALLFTVAGFILHVVLRRLISPEFDKVKCGMVKKTSMERDR
RTDVRRVKEILPVTTEYDPMDYIDLNKGIFIGLSREGEPQYIPLKEWQTQHADIIGTTGAGKGVVTGILL
YQSILADEGVFVLDPKNDEWAPHLYKKACADAGKPFVLIDLNKQEYQMNLIDGITADHLEELFVAGFSLA
EKGEAADFYRIDDRKAARTAAQFVKDNPGATVRDIYNGDYVQGIGETIKAFHGKTEELAMLNSINAPGGF
ALKEIFDKGGCCYIIGSMRNSKIITAQRMILVRLFQLAELRDRVAGNIRPIAIFKDEVKYHLSKPALEGL
GAARDKGVHILMAHQSIADLRDCPADLNGDAVVGAVVENCKFKLVYKLQDPDTAEWIARMSGTILVDDES
RKVTTTAVLTEKVDNERMLRQAESYYIDSNMLQNLPKFVSYIFSQNALAFPSLISPLKVKKAPLELFTLP
PVAVATVAEVKPVLDLDFDKTAPAVPAPDIIPVSATTTKKPSATPIPTPPVQPDEEWLMASQPAPNDEIH
SLLDL
 
Nucleotide Sequence: 1908 bp     [Download]
>gi|194733773|ref|NC_011092.1|:103389-105296 Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 plasmid pCVM19633_110, complete sequence
GTGATATTCGACAAACTGAATCATTTGCTGTCGCCGATAGCAAATGCCGTCCTGGCCTTTATCGCCTTTT
TGCAGGCGCATCAACTGGCGTTAGCGCTGCTGTCCGGCGTCATGCTGCCTTTTATATTTTCTGCGAAACA
CGGCGGTCAGGAAAAGCCGACGTTTCTGCAAAGGATCTTAATTCTGCTTTCCATGATCTGTTTTGTTTTC
GGCTCGATAGCGCCAGTGGCCGTCTGGTTTTTACAGCGCATTTATGGCCGGGAAGATATCGCCAGTCCGC
CGCTGCTTACCTGGACAATGGCGCTACTGTTTACCGTCGCCGGTTTTATTCTGCACGTGGTTTTACGGCG
TTTGATCTCGCCTGAATTTGATAAGGTCAAATGCGGCATGGTGAAAAAAACCAGCATGGAGCGCGACCGC
AGAACCGACGTTCGCCGGGTAAAAGAAATTTTACCCGTCACCACAGAATACGATCCGATGGATTACATCG
ATCTGAATAAGGGGATTTTTATCGGGCTGAGCCGCGAGGGTGAGCCGCAATATATTCCGTTAAAAGAATG
GCAGACCCAGCACGCCGACATTATCGGCACCACTGGTGCCGGTAAAGGCGTCGTAACCGGTATTCTGCTT
TATCAGAGCATCCTCGCCGACGAGGGCGTTTTTGTTCTCGACCCCAAAAACGACGAGTGGGCACCGCACC
TGTATAAAAAAGCGTGCGCGGACGCCGGAAAACCCTTTGTGCTTATCGACCTGAATAAACAGGAATACCA
GATGAACCTTATCGACGGTATCACCGCCGACCATCTGGAGGAATTATTCGTGGCCGGTTTCAGTCTGGCG
GAAAAAGGCGAGGCGGCGGATTTTTACCGTATCGACGACCGCAAGGCGGCGAGAACGGCGGCGCAGTTCG
TGAAGGATAATCCGGGCGCAACCGTGCGGGATATTTATAACGGCGATTATGTTCAGGGCATTGGCGAGAC
GATTAAAGCCTTTCACGGTAAAACCGAGGAGCTGGCAATGCTCAACAGCATTAACGCGCCAGGCGGTTTT
GCGCTGAAGGAGATTTTCGACAAGGGCGGCTGCTGCTATATCATCGGTTCGATGCGTAACTCTAAAATCA
TTACCGCGCAGCGCATGATTTTAGTTCGCCTGTTCCAGCTCGCGGAATTGCGCGACCGCGTCGCGGGGAA
TATCCGCCCCATCGCCATCTTTAAGGACGAGGTGAAATATCACCTGTCCAAACCGGCGCTCGAAGGGTTA
GGCGCGGCACGCGATAAAGGCGTCCATATATTAATGGCGCACCAGTCAATTGCCGACCTGCGCGACTGTC
CGGCGGATTTAAACGGCGACGCCGTGGTTGGGGCGGTTGTGGAAAACTGCAAGTTTAAGCTGGTATATAA
ACTTCAGGATCCAGACACCGCCGAATGGATTGCGCGCATGTCGGGCACGATTTTAGTCGATGATGAAAGC
CGGAAAGTCACCACCACGGCGGTGCTGACAGAAAAAGTCGATAACGAGCGCATGCTTCGGCAGGCGGAAA
GCTATTACATCGACAGCAATATGCTCCAGAACCTGCCGAAGTTCGTCAGCTATATCTTCAGCCAGAACGC
GCTCGCGTTCCCGTCGTTAATCTCACCGCTCAAGGTTAAAAAAGCCCCACTGGAGCTGTTTACCCTGCCG
CCGGTCGCAGTCGCTACGGTGGCAGAAGTTAAACCGGTGCTGGATCTGGATTTTGATAAAACGGCTCCGG
CAGTTCCGGCACCTGACATTATTCCGGTCAGCGCAACAACCACCAAAAAACCCTCAGCAACGCCAATACC
CACTCCGCCGGTGCAACCTGACGAGGAGTGGCTGATGGCATCACAGCCCGCTCCAAATGACGAAATACAT
TCGTTGCTGGATTTATAA
 Primer design