SecReT4
Protein ID: 194733800
T4SS name [ID]VirB [466]
Gene symbolvirB1
Locus tagSeSA_B0116
StrainSalmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
Repliconplasmid pCVM19633_110 [GenBank: NC_011092] [Browse all T4SS(s) in this replicon]
Location [Strand]97602..98651 [+]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDB4TM72
KEGG IDsew:SeSA_B0116
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.5e-47, Aligned region: 26..318
Protein Sequence: 349 a.a.     [Download]
>gi|194733800|ref|YP_002112992.1| P-type DNA transfer ATPase VirB11 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633]
MDDKLTDTPSEGNVALSHLRDLLFGDYLSREGLTEIAINRPGELHTKINGAWEMHASPVTLRQCSSFARA
LAVWNNDTIDETSPILSATLPTGERCQIVVPPACERNTISITLRKPDYFQRTHQSYIDAGFYDRVQGTEK
VESKDGELSRIYLSGNIPLFMEKCVEYGKTLFVVGETGSGKTTYMKMLLHYIPETLRLITIEDNPELKFY
SQKNYVHLFYPADAGEGAIVTSDRLVRAIYRMNPDRPLLAEVRGREAWDALKLIESGHEGFMSSLHAGSP
RECISGLIDRCYEHPACRGMPVDVLLRKVLHCVDVIVSVDVHGNVRRMSDVYFKPLHMQAMKESFNDAA
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|194733773|ref|NC_011092.1|:97602-98651 Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 plasmid pCVM19633_110, complete sequence
ATGGACGATAAACTGACTGATACCCCGTCAGAGGGCAACGTCGCGCTGTCACACCTGCGCGATCTGTTGT
TCGGGGACTACCTGAGCCGGGAGGGGCTGACGGAAATTGCCATCAACCGCCCCGGAGAGCTGCACACAAA
AATCAACGGGGCGTGGGAAATGCACGCCTCGCCGGTCACGCTGCGCCAGTGCTCGTCCTTTGCCAGGGCG
CTGGCCGTGTGGAACAACGACACCATTGATGAAACGTCGCCTATCCTCTCGGCCACGCTCCCTACAGGAG
AACGCTGCCAGATAGTGGTGCCCCCGGCCTGTGAGCGTAACACCATCTCAATCACCCTGCGTAAGCCGGA
CTACTTCCAGCGCACCCATCAGTCGTATATCGATGCCGGGTTTTATGACCGGGTGCAGGGTACAGAAAAG
GTGGAATCAAAAGACGGGGAGCTGAGCCGCATATACCTGTCCGGGAATATCCCGCTTTTTATGGAAAAGT
GCGTGGAGTACGGCAAAACGCTCTTTGTGGTGGGGGAAACAGGCTCTGGGAAAACCACCTACATGAAGAT
GCTGCTGCACTACATTCCCGAGACGCTGCGCCTTATCACCATCGAGGACAACCCGGAGCTGAAGTTTTAC
AGCCAGAAAAACTACGTTCATCTGTTCTACCCGGCGGACGCCGGAGAGGGCGCAATAGTCACCTCTGATC
GCCTGGTGCGCGCGATTTACCGTATGAACCCCGACCGCCCCCTGCTCGCCGAGGTGCGTGGCCGCGAGGC
GTGGGACGCACTCAAGCTGATTGAGTCCGGGCACGAGGGGTTTATGTCCTCCCTGCACGCGGGCAGCCCG
CGCGAGTGTATCTCCGGGCTGATTGACCGCTGCTACGAGCATCCGGCGTGCCGGGGCATGCCGGTTGACG
TGCTGCTGCGCAAGGTACTGCACTGCGTCGACGTCATTGTGAGCGTGGACGTTCACGGCAACGTGCGCCG
CATGAGCGACGTCTATTTTAAACCCCTGCACATGCAGGCTATGAAGGAGAGTTTCAATGATGCTGCCTAA
 Primer design