SecReT4
Protein ID: 194733810
T4SS name [ID]VirB [466]
Gene symbol-
Locus tagSeSA_B0112
StrainSalmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
Repliconplasmid pCVM19633_110 [GenBank: NC_011092] [Browse all T4SS(s) in this replicon]
Location [Strand]94700..94840 [+]
Producthypothetical protein
Component typeVirB7
UniProt IDB4TM68
KEGG IDsew:SeSA_B0112
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 46 a.a.     [Download]
>gi|194733810|ref|YP_002112988.1| hypothetical protein SeSA_B0112 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633]
MKYGITLLMLCLLAGCAQRNTQLPPVSGNPEPVNSPAIIQELTPHV
 
Nucleotide Sequence: 141 bp     [Download]
>gi|194733773|ref|NC_011092.1|:94700-94840 Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 plasmid pCVM19633_110, complete sequence
ATGAAATACGGCATCACGCTGCTGATGCTGTGCCTGCTTGCAGGCTGCGCACAGCGAAACACCCAACTTC
CGCCCGTGTCGGGCAACCCGGAGCCGGTCAATTCCCCGGCCATTATTCAGGAGTTAACCCCCCATGTCTG
A
 Primer design