SecReT4
Protein ID: 194733895
T4SS name [ID]VirB [466]
Gene symbol-
Locus tagSeSA_B0113
StrainSalmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
Repliconplasmid pCVM19633_110 [GenBank: NC_011092] [Browse all T4SS(s) in this replicon]
Location [Strand]94833..95519 [+]
ProductTriG protein
Component typeVirB8
UniProt IDB4TM69
KEGG IDsew:SeSA_B0113
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 8.9e-49, Aligned region: 12..223
Protein Sequence: 228 a.a.     [Download]
>gi|194733895|ref|YP_002112989.1| TriG protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633]
MSELTAKALSDSRSFENAILERDMRMKKAGWIVAALAGLLLVFALAALILLLPLKTTTVELYTLDRQTGR
IERVTTVGEDKLDTSEVLNLSQTASYVKRREGYNYFALQQDYRETQMFNSDEVNKEYLDWFNSPDAPDAV
FQQAAYVVTVEVLSNVPSEGTGSSMVEMLRIKRTIRKVKDNTETYDYWTVRMTYRYFPQKKMTASEREVN
PFGFIVTSYQRFKEKSDE
 
Nucleotide Sequence: 687 bp     [Download]
>gi|194733773|ref|NC_011092.1|:94833-95519 Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633 plasmid pCVM19633_110, complete sequence
ATGTCTGAACTTACCGCCAAAGCCCTGAGCGACTCGCGCTCGTTTGAGAACGCCATTCTTGAGCGGGATA
TGCGCATGAAAAAGGCGGGCTGGATCGTGGCGGCGCTCGCCGGTCTGCTGCTCGTCTTCGCCCTTGCCGC
CCTTATCCTGCTGCTACCGCTCAAAACCACCACCGTGGAGCTGTACACGCTCGACCGTCAGACCGGGCGC
ATCGAGCGCGTCACCACCGTCGGCGAGGACAAGCTGGACACCTCCGAGGTGCTCAATCTCTCGCAGACTG
CGTCCTACGTGAAGCGCCGCGAGGGGTACAACTATTTCGCCCTTCAGCAGGACTACAGAGAGACGCAGAT
GTTCAACAGCGACGAGGTCAACAAGGAATACCTCGACTGGTTTAACAGCCCGGACGCGCCGGACGCTGTG
TTTCAGCAGGCGGCCTATGTAGTCACGGTGGAAGTCCTCTCCAACGTACCGTCAGAGGGCACCGGCTCCA
GCATGGTGGAGATGCTGCGCATCAAGCGCACCATTCGAAAGGTCAAGGACAACACCGAAACGTATGATTA
CTGGACGGTGCGCATGACCTACCGCTATTTCCCGCAGAAGAAAATGACGGCCTCCGAGCGCGAGGTGAAC
CCGTTCGGCTTCATCGTCACCAGTTACCAGCGGTTTAAGGAGAAAAGCGATGAATAA
 Primer design