SecReT4
Protein ID: 197103153
T4SS name [ID]VirB [194]
Gene symbolvirB8
Locus tagPHZ_p0013
StrainPhenylobacterium zucineum HLK1
Repliconplasmid unnamed [GenBank: NC_011143] [Browse all T4SS(s) in this replicon]
Location [Strand]12816..13496 [+]
ProductVirB8 type IV secretion protein
Component typeVirB8
UniProt IDB4RHY1
KEGG IDpzu:PHZ_p0013
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.6e-62, Aligned region: 15..223
Protein Sequence: 226 a.a.     [Download]
>gi|197103153|ref|YP_002128531.1| VirB8 type IV secretion protein [Phenylobacterium zucineum HLK1]
MTGVPANDLQAYFREARSWDQDRALAAERSRRFAWIVAGVATATAVAAIAAVTALAPLKSVSPFVVRVNQ
TTGAVDVMTALNGTRPTQYNEAVDKYFLAQYVRAREGWIAPAAEENFRFVSILSTPDEQERWAAAARPTN
PQSPQAVYGPTGLADVQIRNISFINDRVANVRFHRTVRQATATTESDWIATVTFSYTKAPMLESDRLRNP
LGFQVESYRADPEIPR
 
Nucleotide Sequence: 681 bp     [Download]
>gi|197103140|ref|NC_011143.1|:12816-13496 Phenylobacterium zucineum HLK1 plasmid unnamed, complete sequence
ATGACTGGCGTCCCCGCAAACGACCTGCAGGCCTATTTCCGAGAAGCGCGCTCCTGGGACCAGGACCGGG
CGTTGGCCGCCGAGCGATCGCGCCGTTTCGCCTGGATCGTGGCCGGCGTCGCCACCGCCACGGCCGTCGC
GGCGATCGCTGCCGTGACAGCGCTTGCCCCGCTGAAGTCGGTCTCCCCCTTCGTGGTCCGGGTGAACCAG
ACCACGGGCGCTGTCGACGTGATGACTGCGCTCAACGGGACCAGGCCGACCCAGTACAACGAAGCCGTCG
ACAAGTACTTCCTCGCTCAATACGTCCGAGCCCGCGAGGGTTGGATTGCGCCGGCTGCCGAAGAGAACTT
CCGCTTCGTCTCGATCCTTTCAACACCTGACGAACAGGAACGCTGGGCGGCTGCGGCGCGTCCGACAAAC
CCGCAGAGCCCTCAGGCCGTGTACGGTCCGACAGGCCTCGCCGACGTCCAAATCCGCAACATCAGTTTCA
TCAACGACAGGGTGGCGAACGTCCGCTTCCACCGCACCGTGCGCCAGGCCACCGCCACCACGGAGAGCGA
TTGGATCGCGACCGTCACGTTCAGCTACACCAAGGCTCCGATGCTGGAGTCGGACCGGCTCCGCAATCCG
CTTGGCTTCCAGGTCGAGAGCTATCGCGCCGATCCGGAGATCCCGCGATGA
 Primer design