SecReT4
Protein ID: 197103156
T4SS name [ID]VirB [194]
Gene symbolvirB11
Locus tagPHZ_p0016
StrainPhenylobacterium zucineum HLK1
Repliconplasmid unnamed [GenBank: NC_011143] [Browse all T4SS(s) in this replicon]
Location [Strand]15543..16541 [+]
ProductVirB11 type IV secretion protein
Component typeVirB11
UniProt IDB4RHY4
KEGG IDpzu:PHZ_p0016
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.5e-76, Aligned region: 12..311
FtsK_SpoIIIE [PF01580], Evalue: 1.2e-05, Aligned region: 148..180
Protein Sequence: 332 a.a.     [Download]
>gi|197103156|ref|YP_002128534.1| VirB11 type IV secretion protein [Phenylobacterium zucineum HLK1]
MSDTAVLRHHLTPLAPLLEAPEVTELVINRPGEVGVEGPGGWRWHDAPDLTPSWLSTLATTAAAFTNQDV
TASEPVCSTVLPGGERCQIVLPPAAETISFTIRKPSAAEFGMQDLVASGLFEGAKSATEELAPEETELMA
LRDAGRWPEFFELAVRARKNILISGATGSGKTTFSKTLIKLIPPGERLLTIEDARELVVPHRNVVHLIYA
KDGQGLAKVGAKQLLESALRMRPDRILLQELRDGSAFFYLRNVNSGHPGSITTVHADSAQLAFEQLTLLV
KESEGGRDLSRTDIRTLLLLLVDVVVQMKREAGRFRMTEVYYDPLRKCDPRR
 
Nucleotide Sequence: 999 bp     [Download]
>gi|197103140|ref|NC_011143.1|:15543-16541 Phenylobacterium zucineum HLK1 plasmid unnamed, complete sequence
ATGAGTGACACGGCCGTCCTTCGCCACCACCTGACGCCCCTCGCGCCTCTGCTCGAGGCGCCAGAGGTCA
CGGAGCTGGTCATCAATCGTCCGGGTGAGGTGGGTGTGGAAGGTCCGGGCGGATGGCGTTGGCATGACGC
GCCGGATCTGACGCCAAGCTGGCTGTCGACCCTGGCGACAACCGCCGCCGCCTTCACCAATCAGGATGTC
ACCGCGTCCGAGCCTGTTTGCTCGACAGTGCTCCCTGGCGGCGAGCGCTGCCAGATCGTCTTGCCGCCGG
CGGCGGAGACGATCTCGTTCACCATCCGCAAGCCCTCGGCGGCGGAGTTCGGCATGCAGGACCTGGTCGC
CTCGGGATTGTTCGAAGGCGCGAAATCGGCGACCGAGGAGCTCGCTCCCGAAGAGACCGAACTGATGGCG
CTCCGGGACGCCGGCCGCTGGCCGGAGTTCTTCGAACTCGCGGTGCGGGCTCGCAAGAACATCCTGATCA
GCGGCGCCACCGGCTCTGGCAAGACGACCTTCTCGAAGACGCTGATCAAGCTGATCCCGCCTGGGGAGCG
GCTCCTGACGATCGAGGACGCGCGAGAACTGGTGGTGCCTCACCGCAACGTCGTTCACCTGATCTACGCC
AAGGACGGGCAGGGGCTCGCCAAGGTGGGCGCCAAGCAGCTGCTCGAAAGCGCTCTACGTATGAGGCCGG
ACAGAATCCTCTTGCAGGAGCTTCGGGACGGCTCGGCCTTCTTCTACCTGCGGAACGTGAACTCCGGCCA
CCCGGGATCGATCACCACGGTGCATGCCGACTCCGCCCAACTCGCGTTCGAGCAGCTGACGCTCCTGGTG
AAGGAGTCCGAAGGCGGCCGCGACCTGTCGCGGACCGACATCCGCACGCTCCTCCTGCTGCTCGTAGACG
TCGTCGTCCAGATGAAGCGCGAGGCCGGCCGCTTCCGCATGACGGAGGTCTATTATGACCCCCTTCGCAA
GTGCGACCCCCGCCGGTAA
 Primer design