SecReT4
Protein ID: 197104976
T4SS name [ID]Trb [326]
Gene symboltrbC
Locus tagPHZ_c1513
StrainPhenylobacterium zucineum HLK1
Repliconchromosome [GenBank: NC_011144] [Browse all T4SS(s) in this replicon]
Location [Strand]1717242..1717562 [+]
Productconjugal transfer protein
Component typeTrbC
UniProt IDB4RAB7
KEGG IDpzu:PHZ_c1513
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.3e-25, Aligned region: 6..96
Protein Sequence: 106 a.a.     [Download]
>gi|197104976|ref|YP_002130353.1| conjugal transfer protein [Phenylobacterium zucineum HLK1]
MIRRIRGRLASASAVATVWLLAGPAYAAGSSMPWEAPLQKILQSIEGPVAKIIAVIIIITTGLTLAFGDT
SGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 321 bp     [Download]
>gi|197103466|ref|NC_011144.1|:1717242-1717562 Phenylobacterium zucineum HLK1 chromosome, complete genome
ATGATCCGCCGCATTCGCGGGCGGCTCGCGAGCGCGAGCGCCGTCGCAACCGTCTGGCTGCTCGCCGGGC
CGGCCTACGCCGCCGGCTCATCCATGCCCTGGGAAGCCCCGCTGCAGAAAATCCTGCAGTCGATCGAGGG
CCCCGTGGCCAAGATCATCGCGGTGATCATCATCATCACCACAGGCCTGACCCTGGCCTTTGGCGACACC
TCGGGTGGCTTTCGACGGCTGATCCAGATCGTCTTCGGCCTCTCGATCGCCTTCGCCGCCTCCAGCTTCT
TCCTGTCCTTCTTCTCGTTCGGCGGCGGGGCGCTGGTCTGA
 Primer design