SecReT4
Protein ID: 197104980
T4SS name [ID]Trb [326]
Gene symboltrbL
Locus tagPHZ_c1517
StrainPhenylobacterium zucineum HLK1
Repliconchromosome [GenBank: NC_011144] [Browse all T4SS(s) in this replicon]
Location [Strand]1721238..1722404 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDB4RAC1
KEGG IDpzu:PHZ_c1517
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2e-52, Aligned region: 36..261
Protein Sequence: 388 a.a.     [Download]
>gi|197104980|ref|YP_002130357.1| conjugal transfer protein TrbL [Phenylobacterium zucineum HLK1]
MNPGVADRFLDVFSRYIDSGFGLLGGEVAFLASTLVVIDVTLAALFWSWSAGDDVIARLIKKTLYVGFFA
FLLSNFNGLAKIVFQSFSGLGLKAAGSGMSAADFLRPGKLAQSGIDAGRPLLQAAHEMSGFPGFFDNFAQ
IIVIMVAWLIVLIAFFVLAVQLFVTLIEFKLTTLAGFILVPFGLFGRTAFLAERVLGNVVASGVKVLVLA
VIVGIGSTLFGEFIQDFGGQQPSLEEVLSLALASLCLLGLGIFGPAVANGLVSGAPQLGAGAAVGTGLAA
GGLAAAGAMGTRAAIGAGVGGARGAIAAARGFRSGPSGSGDSGLRPNPPSGPGGHAGGGPGGGGAPAWAR
QYQRRQEAAHGAATAAHALRSGDHPGGGTSVSLAEDRS
 
Nucleotide Sequence: 1167 bp     [Download]
>gi|197103466|ref|NC_011144.1|:1721238-1722404 Phenylobacterium zucineum HLK1 chromosome, complete genome
ATGAACCCCGGCGTCGCTGATCGCTTCCTGGACGTCTTCTCGCGCTACATCGACTCGGGCTTTGGCCTGC
TCGGCGGAGAAGTTGCCTTCCTGGCAAGCACCCTGGTGGTGATCGACGTCACCCTGGCGGCGCTGTTCTG
GTCCTGGTCGGCCGGCGACGACGTGATCGCCCGGCTCATCAAGAAGACGCTGTACGTCGGCTTCTTCGCC
TTCCTACTGTCGAACTTCAACGGACTGGCGAAGATCGTCTTCCAGTCCTTCTCGGGTCTGGGCCTCAAAG
CCGCGGGCAGCGGCATGTCCGCCGCCGACTTCCTGCGTCCGGGCAAGCTGGCGCAATCAGGCATCGACGC
AGGAAGGCCTCTCCTGCAAGCGGCGCACGAGATGTCCGGCTTCCCCGGCTTCTTCGACAACTTCGCTCAG
ATCATCGTCATCATGGTGGCCTGGCTCATCGTCCTCATCGCCTTCTTCGTGCTCGCGGTGCAGCTCTTCG
TCACCCTGATCGAGTTCAAGCTGACGACGCTGGCCGGCTTCATTCTCGTGCCCTTCGGCCTCTTCGGGCG
GACGGCTTTTCTGGCCGAGCGTGTGCTCGGAAATGTCGTCGCCTCCGGCGTGAAGGTGCTGGTCCTGGCG
GTGATCGTTGGGATTGGCTCCACCTTGTTCGGCGAGTTCATCCAGGACTTCGGCGGGCAGCAACCCTCGC
TGGAGGAGGTGCTCTCCCTGGCGCTGGCGTCGCTCTGCCTCCTTGGTCTCGGCATCTTCGGGCCCGCCGT
CGCCAATGGCCTGGTGTCGGGGGCGCCGCAGCTCGGGGCAGGGGCCGCCGTCGGGACTGGCCTCGCCGCC
GGCGGCCTCGCGGCTGCTGGCGCAATGGGCACGCGCGCCGCGATCGGCGCCGGCGTCGGGGGCGCGCGAG
GCGCCATCGCTGCCGCGCGTGGCTTCCGCTCCGGTCCCTCGGGCTCCGGTGACAGCGGCTTACGGCCCAA
TCCGCCCTCCGGACCCGGCGGACATGCGGGTGGTGGGCCTGGAGGCGGCGGCGCGCCGGCGTGGGCACGC
CAATACCAGCGCCGTCAGGAAGCGGCCCACGGCGCCGCGACCGCCGCCCACGCCCTTCGTTCCGGCGACC
ATCCCGGCGGCGGAACCTCCGTCTCGCTCGCAGAGGATCGGTCATGA
 Primer design