SecReT4
Protein ID: 197104982
T4SS name [ID]Trb [326]
Gene symboltrbG
Locus tagPHZ_c1519
StrainPhenylobacterium zucineum HLK1
Repliconchromosome [GenBank: NC_011144] [Browse all T4SS(s) in this replicon]
Location [Strand]1723087..1724067 [+]
Productconjugal transfer protein
Component typeTrbG
UniProt IDB4RAC3
KEGG IDpzu:PHZ_c1519
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.3e-67, Aligned region: 103..322
Protein Sequence: 326 a.a.     [Download]
>gi|197104982|ref|YP_002130359.1| conjugal transfer protein [Phenylobacterium zucineum HLK1]
MRAPTLILMLAGTTLSGCAAMQAEQSKPASTVPATAPALAPAPVPRGPIVVASTPVPNPPERAARKPAAG
PVRPAPETGDPAARVARANAAARVQPTGSAYANAAQIYPYAEGALFQVYTAPGRITDITLEEGETLSGTG
PVAAGDTARWIIGDTESGSGASRRVHILVKPTRADLQTNLVINTNRRTYHLELRATPATYMASVAWRYPA
DEALAAAESVERYAAPTVAIEQLNFNYRISGDRPSWRPVRVFDDGRQTFIEFAPSVTQGELPPLFVGGAD
GKAADLVNYRVSGQRMVVDRLFTRAELRLGDRRGQKRVRIERGAGG
 
Nucleotide Sequence: 981 bp     [Download]
>gi|197103466|ref|NC_011144.1|:1723087-1724067 Phenylobacterium zucineum HLK1 chromosome, complete genome
ATGCGAGCCCCGACGCTAATCCTGATGTTGGCCGGGACGACCCTCAGCGGCTGCGCGGCGATGCAGGCCG
AGCAATCCAAGCCCGCTTCTACGGTCCCCGCCACCGCGCCTGCGCTCGCGCCAGCGCCCGTCCCACGCGG
CCCGATTGTCGTGGCTTCGACGCCGGTTCCGAACCCGCCTGAGCGGGCCGCACGAAAGCCTGCCGCGGGT
CCTGTCCGGCCTGCGCCCGAGACCGGCGATCCCGCGGCACGGGTGGCCAGGGCCAATGCCGCCGCCAGGG
TGCAGCCGACCGGATCGGCCTATGCCAACGCCGCGCAGATCTACCCCTACGCCGAGGGCGCTCTGTTCCA
GGTCTACACCGCGCCTGGCCGCATCACTGACATCACCCTGGAAGAGGGAGAGACCCTCTCCGGAACCGGT
CCGGTGGCTGCAGGCGACACCGCGCGCTGGATCATCGGCGACACGGAGAGCGGCTCGGGCGCAAGCCGGC
GGGTGCACATCCTGGTCAAGCCCACCCGAGCTGATCTGCAGACCAACCTGGTGATCAACACCAATCGCAG
GACCTATCACCTGGAGCTGCGCGCGACTCCCGCGACCTACATGGCGTCGGTCGCTTGGCGCTATCCCGCC
GATGAGGCCTTGGCCGCGGCCGAGAGCGTCGAGCGCTACGCCGCGCCCACGGTCGCGATCGAGCAGCTCA
ACTTCAACTACAGGATTTCGGGCGACCGCCCGTCCTGGCGTCCGGTGCGCGTGTTCGATGATGGCCGGCA
GACCTTCATCGAGTTCGCCCCTTCGGTGACGCAAGGCGAGCTGCCGCCGCTGTTCGTCGGTGGCGCCGAC
GGAAAGGCGGCCGACCTCGTGAACTACCGTGTGAGCGGCCAGCGGATGGTGGTGGATCGCCTATTCACTC
GGGCCGAGCTGCGGCTCGGCGATCGTCGCGGCCAGAAGCGGGTGCGCATCGAACGCGGTGCGGGAGGATG
A
 Primer design