SecReT4
Protein ID: 197105815
T4SS name [ID]VirB [23]
Gene symbolvirB8
Locus tagPHZ_c2353
StrainPhenylobacterium zucineum HLK1
Repliconchromosome [GenBank: NC_011144] [Browse all T4SS(s) in this replicon]
Location [Strand]2665482..2666162 [+]
ProductType IV secretory pathway, component VirB8
Component typeVirB8
UniProt IDB4RFV0
KEGG IDpzu:PHZ_c2353
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 8.9e-62, Aligned region: 15..223
Protein Sequence: 226 a.a.     [Download]
>gi|197105815|ref|YP_002131192.1| Type IV secretory pathway, component VirB8 [Phenylobacterium zucineum HLK1]
MTGVPSPDLKAYFAEARSWDADRLRQANRSRRVAWSVAAGASALATAAVCAVAALSPLKTVEPYVVRVDR
STGAVEVMTGLNEAGDLTYEEAVTKSFLATYVRARESWLPPAAEANFRQVSIMSTPAEQQRWAERFRPSN
PLSPQVAWGPNAEAEARVRAITFVAPQVASVRFHRTLRQQGQLTESDWIATVAFGYARAPMSESDRLRNP
LGFQVSSYRADPEVIQ
 
Nucleotide Sequence: 681 bp     [Download]
>gi|197103466|ref|NC_011144.1|:2665482-2666162 Phenylobacterium zucineum HLK1 chromosome, complete genome
ATGACGGGCGTCCCGTCTCCGGACCTGAAGGCCTACTTCGCCGAGGCGCGTAGCTGGGACGCCGATCGCC
TGCGCCAGGCGAACCGCTCCCGCCGCGTGGCCTGGAGCGTGGCCGCTGGCGCGTCCGCGCTCGCCACAGC
CGCAGTGTGCGCCGTCGCCGCGCTCTCGCCGCTCAAGACCGTGGAGCCCTACGTGGTCCGGGTCGACCGG
AGCACGGGCGCCGTCGAGGTGATGACAGGGCTCAACGAGGCCGGTGACCTGACTTACGAAGAGGCGGTCA
CCAAGTCCTTCCTGGCGACCTATGTCCGGGCGCGGGAGTCGTGGCTGCCGCCTGCCGCCGAGGCGAACTT
CCGTCAGGTTTCAATCATGTCGACGCCAGCCGAGCAGCAGCGCTGGGCAGAGCGCTTCCGACCATCGAAC
CCCCTGAGCCCTCAGGTGGCCTGGGGACCGAACGCGGAAGCTGAGGCGCGGGTCCGCGCCATAACCTTCG
TCGCCCCCCAGGTCGCCAGTGTGAGGTTCCACCGGACCTTAAGACAGCAAGGTCAGCTGACCGAAAGCGA
CTGGATCGCAACCGTGGCCTTCGGCTACGCCCGGGCGCCGATGTCGGAGTCCGACAGGTTGCGCAATCCG
CTGGGCTTCCAGGTTTCGAGCTACCGCGCGGACCCGGAGGTCATCCAATGA
 Primer design