SecReT4
Protein ID: 197105818
T4SS name [ID]VirB [23]
Gene symbol-
Locus tagPHZ_c2356
StrainPhenylobacterium zucineum HLK1
Repliconchromosome [GenBank: NC_011144] [Browse all T4SS(s) in this replicon]
Location [Strand]2668046..2669038 [+]
ProductvirB11 type IV secretion protein
Component typeVirB11
UniProt IDB4RFV3
KEGG IDpzu:PHZ_c2356
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7.3e-73, Aligned region: 12..309
AAA_29 [PF13555], Evalue: 1.6e-05, Aligned region: 144..185
Protein Sequence: 330 a.a.     [Download]
>gi|197105818|ref|YP_002131195.1| virB11 type IV secretion protein [Phenylobacterium zucineum HLK1]
MGDVAILNHHLRPLRAALDADGTTELVVNRPGEFAVERRGAWLWHEAPELTTEWLRTLAIGAAAATAQDV
SPDRPICSTVLPSGERCQIVLPPAAEHPSLTLRRPSPTAFELADLARSGLFENVATAPDDEADAAMRALQ
AAGDWPGFFGRAVRARRNIVVSGATGSGKTTLAKALLRLIPPDERLITVEDAREFITPHRNVVHLLYSKD
GQGLAKVGPKALLESALRMRPDRILLQELRDESAFFYLRNVNSGHPGSITTVHADSASLAFEQLTLLIKE
SEGGRHLAREDIRGMLRMLVDVVVHVVRRGERFGVREIWYDPELKRTLAA
 
Nucleotide Sequence: 993 bp     [Download]
>gi|197103466|ref|NC_011144.1|:2668046-2669038 Phenylobacterium zucineum HLK1 chromosome, complete genome
ATGGGCGACGTGGCGATCCTCAATCACCACCTCCGCCCTTTGCGAGCTGCGCTCGACGCCGACGGGACGA
CAGAGCTTGTGGTCAATCGACCAGGCGAGTTTGCGGTGGAGCGCCGCGGCGCCTGGTTGTGGCATGAGGC
GCCGGAGCTGACGACCGAGTGGCTGCGCACTCTGGCGATCGGGGCGGCCGCAGCGACGGCCCAGGATGTC
AGCCCCGACCGTCCGATCTGCTCCACCGTCCTTCCGTCCGGCGAGCGCTGCCAGATCGTCCTGCCACCCG
CAGCAGAGCACCCCTCGCTCACACTGAGACGCCCCTCGCCAACAGCCTTTGAACTCGCGGACCTGGCCCG
GTCAGGGTTGTTCGAGAACGTCGCCACCGCCCCGGACGACGAGGCAGATGCGGCCATGCGCGCCCTGCAG
GCCGCTGGAGACTGGCCCGGCTTCTTCGGCCGCGCCGTCCGCGCGCGTCGAAACATCGTCGTGAGCGGAG
CGACCGGCTCCGGCAAGACAACGCTCGCCAAGGCGCTACTCCGCCTGATCCCTCCGGATGAGCGGTTGAT
CACGGTGGAGGACGCCCGCGAATTCATCACCCCGCACCGAAACGTCGTCCACCTGCTCTACTCGAAGGAC
GGACAGGGCCTCGCGAAGGTGGGCCCGAAGGCTCTCCTGGAAAGCGCGCTGCGCATGCGACCCGACCGCA
TCCTTCTTCAGGAGCTGCGCGACGAAAGCGCCTTCTTCTATCTGCGCAACGTCAACTCAGGTCATCCCGG
CTCGATCACCACCGTCCATGCCGACTCCGCGAGCCTCGCCTTCGAGCAGCTGACCCTGCTCATCAAGGAG
AGCGAAGGCGGCCGTCACCTGGCTCGTGAGGACATCCGGGGCATGCTCCGCATGCTGGTCGATGTGGTGG
TTCACGTCGTCCGCAGAGGTGAGCGCTTCGGGGTTCGCGAGATCTGGTATGATCCCGAGCTCAAGCGCAC
CCTCGCCGCTTAG
 Primer design